KEGG   Serratia sp. AS13: SerAS13_2666Help
Entry
SerAS13_2666      CDS       T02012                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sra  Serratia sp. AS13
Pathway
sra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01130  Biosynthesis of antibiotics
sra01230  Biosynthesis of amino acids
Module
sra_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SerAS13_2666
Enzymes [BR:sra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SerAS13_2666
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SerAS13_2666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI HHH_4
Motif
Other DBs
NCBI-ProteinID: AEG28443
Position
2867050..2868411
Genome map
AA seq 453 aa AA seqDB search
MQETVLNKIVRDKAQWVAARQQQQPLASFHNEIVPSERGFYHALQGARTAFILECKKASP
SKGLIRENFDPVEIASVYKDFASAISVLTDEKYFQGSFDFLPLVSKAVTQPVLCKDFIID
PYQIYLARFYQADAILLMLSVLDDDQYRQLAAVAHSLNMGVLTEVISEEELQRAIALEAR
VVGINNRDLRDLSIDLDRTRQLAPRVPHGVTVISESGINNYGQIRELSHFANGFLIGSAL
MSETDLRAAVRRVTLGDNKVCGLTRPQDAAAAYQAGAIYGGLIFVGRSPRYVDINRAREV
IAGAPLKYVGVFCDAQVETLVQTVERLGLKAVQLHGAEDQAYIDALRAKLPDSCQIWKAL
SVKDSLPARDLQHVDRYLLDNGAGGTGQRFDWSVLHGQNLGNVMLAGGLSADNCVDAAKL
GCAGLDFNSGVESQPGIKDPARLAAVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtgctcaacaagattgttcgtgataaagcgcaatgggtcgcagcacga
cagcaacaacaaccactggccagctttcacaatgaaatcgtcccaagcgaacgcggcttt
tatcatgcactgcaaggagccagaacggcatttattcttgaatgcaaaaaagcgtcccct
tccaaagggttgatccgtgaaaactttgatccggtcgaaatcgcttcggtctacaaggat
ttcgcttcggccatctcggtactgaccgatgaaaagtacttccagggcagtttcgatttc
ctgccgctggtcagcaaggcggtcacgcagccggtgctgtgcaaagattttattatcgac
ccgtaccaaatctacctggcgcggttctatcaggctgatgccatcctgctgatgttgtcg
gtgctggacgacgatcaatatcgccagttggcagccgtggcgcacagcctgaacatgggc
gtgctgaccgaagtgatcagcgaagaagaactgcagcgggcaatcgcgcttgaggcacgc
gtggtcggcattaacaaccgtgacctgcgcgaccttagcattgatctggaccgtacccgc
caacttgcgccacgcgtgccgcacggggtgacggtgatcagcgaatccggcatcaacaat
tacggccaaatccgcgaactgagccacttcgccaacgggttcctgatcggcagcgcattg
atgtcggaaactgacctgcgcgccgcagtgcgtcgggtgacgctgggcgacaataaagtc
tgcgggctgacccgcccacaagatgccgcagccgcctatcaggcaggcgcgatctacggt
gggctgatttttgtcgggcgttcaccgcgttatgtcgacatcaaccgcgcccgcgaagtg
attgccggtgcgccattgaaatatgtcggcgtgttctgcgatgcgcaggtggaaaccctg
gtgcaaaccgttgaacgcctcggtctgaaggcggtacagctacacggcgcggaagatcaa
gcctatatcgacgccctgcgcgcaaaactgcctgattcctgccagatctggaaagcgctg
agcgtgaaagacagcttgccggcacgtgatctgcagcacgttgaccgctatctgctggat
aacggcgccggcggcaccggccagcgtttcgactggtcggtattgcacggccaaaacctg
ggtaacgtgatgctggcgggcggtctgagcgcagacaactgcgttgacgcagccaaactc
ggctgtgccgggttggactttaactccggcgtcgagagccagcccggaattaaagatcct
gcccgcctggcggcggtatttcaaacgctgcgcgcctactga

DBGET integrated database retrieval system