KEGG   Serratia sp. AS13: SerAS13_2666Help
Entry
SerAS13_2666      CDS       T02012                                 

Definition
Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase (EC:5.3.1.24 4.1.1.48)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sra  Serratia sp. AS13
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sra01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sra00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2867050..2868411
Genome map
AA seq 453 aa AA seqDB search
MQETVLNKIVRDKAQWVAARQQQQPLASFHNEIVPSERGFYHALQGARTAFILECKKASP
SKGLIRENFDPVEIASVYKDFASAISVLTDEKYFQGSFDFLPLVSKAVTQPVLCKDFIID
PYQIYLARFYQADAILLMLSVLDDDQYRQLAAVAHSLNMGVLTEVISEEELQRAIALEAR
VVGINNRDLRDLSIDLDRTRQLAPRVPHGVTVISESGINNYGQIRELSHFANGFLIGSAL
MSETDLRAAVRRVTLGDNKVCGLTRPQDAAAAYQAGAIYGGLIFVGRSPRYVDINRAREV
IAGAPLKYVGVFCDAQVETLVQTVERLGLKAVQLHGAEDQAYIDALRAKLPDSCQIWKAL
SVKDSLPARDLQHVDRYLLDNGAGGTGQRFDWSVLHGQNLGNVMLAGGLSADNCVDAAKL
GCAGLDFNSGVESQPGIKDPARLAAVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtgctcaacaagattgttcgtgataaagcgcaatgggtcgcagcacga
cagcaacaacaaccactggccagctttcacaatgaaatcgtcccaagcgaacgcggcttt
tatcatgcactgcaaggagccagaacggcatttattcttgaatgcaaaaaagcgtcccct
tccaaagggttgatccgtgaaaactttgatccggtcgaaatcgcttcggtctacaaggat
ttcgcttcggccatctcggtactgaccgatgaaaagtacttccagggcagtttcgatttc
ctgccgctggtcagcaaggcggtcacgcagccggtgctgtgcaaagattttattatcgac
ccgtaccaaatctacctggcgcggttctatcaggctgatgccatcctgctgatgttgtcg
gtgctggacgacgatcaatatcgccagttggcagccgtggcgcacagcctgaacatgggc
gtgctgaccgaagtgatcagcgaagaagaactgcagcgggcaatcgcgcttgaggcacgc
gtggtcggcattaacaaccgtgacctgcgcgaccttagcattgatctggaccgtacccgc
caacttgcgccacgcgtgccgcacggggtgacggtgatcagcgaatccggcatcaacaat
tacggccaaatccgcgaactgagccacttcgccaacgggttcctgatcggcagcgcattg
atgtcggaaactgacctgcgcgccgcagtgcgtcgggtgacgctgggcgacaataaagtc
tgcgggctgacccgcccacaagatgccgcagccgcctatcaggcaggcgcgatctacggt
gggctgatttttgtcgggcgttcaccgcgttatgtcgacatcaaccgcgcccgcgaagtg
attgccggtgcgccattgaaatatgtcggcgtgttctgcgatgcgcaggtggaaaccctg
gtgcaaaccgttgaacgcctcggtctgaaggcggtacagctacacggcgcggaagatcaa
gcctatatcgacgccctgcgcgcaaaactgcctgattcctgccagatctggaaagcgctg
agcgtgaaagacagcttgccggcacgtgatctgcagcacgttgaccgctatctgctggat
aacggcgccggcggcaccggccagcgtttcgactggtcggtattgcacggccaaaacctg
ggtaacgtgatgctggcgggcggtctgagcgcagacaactgcgttgacgcagccaaactc
ggctgtgccgggttggactttaactccggcgtcgagagccagcccggaattaaagatcct
gcccgcctggcggcggtatttcaaacgctgcgcgcctactga

DBGET integrated database retrieval system