KEGG   Serratia sp. AS13: SerAS13_2736Help
Entry
SerAS13_2736      CDS       T02012                                 

Definition
Acetaldehyde dehydrogenase (acetylating) (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sra  Serratia sp. AS13
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SerAS13_2736
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS13_2736
   00620 Pyruvate metabolism
    SerAS13_2736
   00650 Butanoate metabolism
    SerAS13_2736
  Lipid metabolism
   00071 Fatty acid degradation
    SerAS13_2736
  Amino acid metabolism
   00350 Tyrosine metabolism
    SerAS13_2736
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SerAS13_2736
   00626 Naphthalene degradation
    SerAS13_2736
Enzymes [BR:sra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SerAS13_2736
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SerAS13_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2932263..2934935
Genome map
AA seq 890 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILSEDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIVGWIDQPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DSGVICASEQSVIVVDSIYDAVRERFSSHGGYLLQGKELKAVQDIILKNGGLNAAIVGQS
APKIAEMAGIKVPSSTKVLIGEVKLVDESEPFAHEKLSPTLAMYRAKDFEDAVSKAEKLV
AMGGIGHTSCLYTDQDNQPERVAFFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQITTVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVLYEHPETHFEDLALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEYLPASYKEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIEKLLVWLDEIKTELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQIMLDTFYGRKFSEADDEEVLVAPVAAKAEKKSKK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaatgtcgctgaactgaacgagctagtcgcacgtgtcaaaaaagcccag
cgcgaatatgccaacttcactcaagagcaagttgataaaatcttccgcgctgctgccctc
gccgctgccgatgcccgtattcccttggccaaaatggccgttgaagaatccggtatgggt
atcgttgaagataaagtgatcaaaaaccacttcgcttcagagtatatctacaacgcgtat
aaagatgaaaaaacctgcggtatcctgtctgaagacgatacctttggcacgatcaccatc
gccgagcctattggcttgatttgcggtatcgtaccgaccaccaacccaacctctacggct
atttttaaagcgctgatcagcctgaaaacccgtaacggcattatcttctcaccacatccg
cgtgcgaaaaacgccaccaacaaagcggcggatatcgtgttgcaggcggcaatcgctgcc
ggggcaccaaaagacatcgtcggctggattgaccagcctaccgttgagctgtccaaccag
ctaatgcaccacccggacatcaacctgatcctcgctaccggcggtccaggtatggtgaaa
gccgcctacagctccggcaagcctgcaatcggtgttggcgccggtaacaccccagtggtg
gttgacgagacagcggacatcaaacgcgttgtggcctctattttgatgtctaaaaccttc
gacagcggtgtgatttgcgcctccgagcagtctgtcatcgtcgttgactccatctatgat
gcagtgcgtgagcgcttctcttcccacggcggctacctgctgcagggcaaagagctgaag
gcggtccaggacatcattctgaaaaacggcggcctgaatgcggccatcgtcggccaatcc
gcgcctaaaatcgctgaaatggccggtatcaaagtgccttccagcaccaaggtactgatc
ggtgaagtgaaattggtcgatgaatccgaacctttcgctcacgaaaagctgtctccgacg
ctggcaatgtatcgcgccaaagattttgaagacgccgtcagcaaagctgaaaaactggtc
gccatgggcggtatcggccatacgtcctgcctgtacaccgaccaggataaccagccggaa
cgcgttgccttcttcggcgacaagatgaaaaccgcacgtatcctgatcaacaccccggcg
tctcagggtggtatcggtgacctgtacaactttaaactcgctccgtcactgacgctgggc
tgcggttcctggggtggtaactccatctctgaaaacgtcggtccaaaacacttgatcaac
aagaaaactgtagcgaagcgagcagaaaacatgttgtggcataaacttccgaaatcaatc
tacttccgccgtggctcattgcctatcgcgctggaagaagtagcgaccgacggggcaaaa
cgcgccttcattgtgaccgaccgctacctgttcaacaacggctatgcagaccagatcacc
acggttctgaaatcgcacggcattgaaacagaagtgttcttcgaagtagaagctgaccca
acgctgtccatcgtgcgtaaaggcgccgagcagatgaactccttcaaaccagacgtgatc
atcgcgctgggcggcggttcaccgatggatgctgcgaagatcatgtgggtgttgtacgag
catccggaaacccatttcgaagacctggcgctgcgctttatggatatccgtaaacgcatc
tacaagttcccgaaaatgggcgtcaaagcaaaaatgattgccgtcaccaccacctcaggt
accggttctgaagtcacgccgtttgcggtagtgaccgacgatgcgaccggccagaaatac
ccgctggctgactacgcattgacgccggatatggcgatcgttgacgccaatctggtgatg
aacatgccgaaatccctctgtgccttcggcggcctggatgcggttacccatgcgctggaa
gcttatgtttcggtactggcgaacgaatactctgacggccaggcgctgcaagcgctgaaa
ttgctgaaagagtatctgcccgccagctacaaggaaggcgccaagaacccggtggcccgt
gagcgcgtgcacaacgccgcgaccattgccggtatcgcgtttgccaacgccttcctgggg
gtttgccactccatggcccacaaactgggctctgagttccatatcccgcacggcctggcc
aacgccatgttgatctccaacgtcattcgctataacgcgaacgacaatccgaccaagcag
acggccttcagccagtacgaccgcccgcaggcacgtcgtcgctacgctgagatcgccgac
cacctcggtctgagcgcaccgggcgaccgtaccgcgcaaaaaatcgagaaactgctggta
tggctggatgagatcaaaaccgagctgggcatccctgcttccatccgtgaagccggcgtg
caggaggctgacttcctggcgaaggtcgacaaactgtccgaagacgcttttgacgaccag
tgtaccggcgccaacccgcgttatccgctgattgccgagctgaagcaaatcatgctggat
accttctacggccgtaagttcagcgaagcggatgatgaagaagttttggttgcaccggtt
gcggccaaagcggaaaaaaagtccaaaaaataa

DBGET integrated database retrieval system