KEGG   Serratia sp. AS13: SerAS13_3166Help
Entry
SerAS13_3166      CDS       T02012                                 

Definition
arylformamidase (EC:3.5.1.9)
Orthology
K01432  
arylformamidase [EC:3.5.1.9]
Organism
sra  Serratia sp. AS13
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SerAS13_3166
  Amino acid metabolism
   00380 Tryptophan metabolism
    SerAS13_3166
Enzymes [BR:sra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.9  arylformamidase
     SerAS13_3166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3354598..3355392)
Genome map
AA seq 264 aa AA seqDB search
MKLVPGSYDNGSTVDNENEILNSFQTRSQAVYQQVRSELNIAYGYSEREVFDWLYSDVPS
KGTLIFVHGGYWQFCRKDDFAFIAEVPLALGFDVVLLEYTLAPVATLEDICRQIGTALDA
IELRLAAQKNAPVYLCGHSAGGHLASYWQQHAVVDAVLPISGIFELEPLLSTYVNRQLQL
TRRQITQLSPARHIPEQLKPMTLFYGAAELPELIGQSLHYYAALREKNLPAELVAVAGAN
HYNVLDALFAADGALIRQLTTTGK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtcccgggaagttacgataacggttcgacagtagacaatgaaaatgagatc
ctgaactcatttcaaacccgcagtcaggccgtttatcagcaagtacgcagcgaacttaat
attgcctatggttattcggaacgggaagtttttgattggttatattctgatgtgccctct
aaaggaacattaatatttgttcacggcggttattggcaattttgccgtaaagacgatttc
gcatttattgccgaggtgccattggcgctgggctttgacgtggtgttgctggaatatacg
ttggcgccggtggcgacactggaggatatttgccggcaaatcggcacggcgctggatgcc
attgaactgcggctggcagcgcaaaaaaacgcgccggtctatttgtgcggccattccgcc
ggcgggcatttggccagttattggcaacagcatgcggttgttgacgcggtattgcccatc
agcggaatttttgaactggaaccgctgttaagcacttacgtaaatcggcaattgcaactg
acccggcggcaaatcacgcagctgagcccggcgcgccatattcctgaacagctaaaaccc
atgacgctgttttacggcgcagccgagctgccggaactgatagggcagtcgcttcattat
tacgctgcgctgcgggagaaaaacctgccggctgagctggttgccgtagcgggagccaat
cattacaacgtactggatgcgctgttcgccgctgacggggcgctgatccggcagttaacc
accacggggaaataa

DBGET integrated database retrieval system