KEGG   Serratia sp. AS13: SerAS13_3180Help
Entry
SerAS13_3180      CDS       T02012                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sra  Serratia sp. AS13
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SerAS13_3180
  Lipid metabolism
   00561 Glycerolipid metabolism
    SerAS13_3180
   00600 Sphingolipid metabolism
    SerAS13_3180
Enzymes [BR:sra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SerAS13_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3378613..3379920)
Genome map
AA seq 435 aa AA seqDB search
MIKVTFMGAGSTIFAKNVLGDIMATPALKEVDIALYDIDSARLNESFTMLSNINRNTNAG
RAKITPYLGVENRRAALKNANYVVNAIQVGGYDPCTITDFTIARKYGLQQTIADTLGIGG
IFRALRTIPVLFDFARDIEAVCPDAWLLNYTNPMAAITGAMLRHTEVKTVGLCHSVQVCA
ETLLKSVDMPTDDVQFHIAGINHMAWLLDVRRHGEDLYPEIKRRANALQGKHDDMVRHEI
MKTFGYYVTESSEHNAEYMPYWIKRNYPELIERFNIPLDEYPRRCIEQIEQWQQQKVALT
HDASLTHCRTHEYASYIIEAMETDRPYKIGGNVLNTGLITNLPAEACVEVPCLVDGQGIT
PCYVGNLPEQLAALNRTNINTQLLTIEAAVTHKREAIYHAALLDPHTSAELSIDDIRKLC
DELIEAHGNWLPAYH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtgacatttatgggcgcgggcagcaccattttcgccaagaacgtactcggc
gacatcatggcgacgccggcattgaaagaggtggatattgcgctgtacgacatcgacagt
gcccgtctcaacgaatccttcaccatgttgagcaatatcaaccgcaataccaatgcgggc
agggcgaagattaccccttacctcggcgtagaaaaccgccgcgcggcattgaaaaacgcc
aattacgtggtgaatgccatccaggtcggcggctacgatccttgcaccatcaccgatttc
accattgccagaaaatacggcttgcagcagaccattgccgataccttgggtattggcggt
atcttccgtgcgctgcgcaccattccggtgttgtttgatttcgcccgggatatcgaagcg
gtctgcccggacgcctggctgctgaactataccaatccgatggcggcaataaccggcgcc
atgctgcgccataccgaagtgaaaacggtggggttgtgccacagcgttcaggtctgcgcc
gagacgctgctgaaaagcgtggatatgccgaccgacgacgtgcagttccacatcgcgggc
atcaaccatatggcctggctgctggacgttcgtcgtcacggcgaagacctgtacccggaa
atcaagcgtcgcgccaatgccttgcagggcaagcatgatgacatggtgcgccatgaaatc
atgaaaaccttcggctattacgtgaccgaatcttcagagcacaatgccgaatacatgcct
tattggatcaaacgcaattatccggaactgattgagcgcttcaatattccgctggatgaa
tacccgcgccggtgtattgagcaaattgaacagtggcagcaacagaaagtggcgctgacc
catgacgccagtctgactcattgccgcactcatgaatatgcttcttacatcatcgaagcg
atggagaccgatcggccctacaagattggcggcaatgtgctcaacaccgggttgatcacc
aacctgcctgcggaggcctgcgtcgaagtgccttgtctggtggatgggcaggggatcacg
ccatgctacgtcggcaacttgccggagcaattggcggcgctgaaccgcacgaatatcaat
acccaactgttgaccattgaagcggcggtcacgcacaaacgcgaggctatctaccatgcg
gcgctgctggatccgcacacctccgccgagctttcgatcgatgacatccgcaagctgtgc
gacgaactgattgaagcgcacggcaactggcttcccgcctaccattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system