KEGG   Serratia sp. AS13: SerAS13_3602Help
Entry
SerAS13_3602      CDS       T02012                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sra  Serratia sp. AS13
Pathway
sra00010  Glycolysis / Gluconeogenesis
sra00052  Galactose metabolism
sra00500  Starch and sucrose metabolism
sra00520  Amino sugar and nucleotide sugar metabolism
sra00521  Streptomycin biosynthesis
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01120  Microbial metabolism in diverse environments
sra01130  Biosynthesis of antibiotics
sra01200  Carbon metabolism
Module
sra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS13_3602
   00052 Galactose metabolism
    SerAS13_3602
   00500 Starch and sucrose metabolism
    SerAS13_3602
   00520 Amino sugar and nucleotide sugar metabolism
    SerAS13_3602
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SerAS13_3602
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SerAS13_3602
Enzymes [BR:sra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SerAS13_3602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AEG29368
Position
complement(3836219..3837181)
Genome map
AA seq 320 aa AA seqDB search
MTYALVGDVGGTNARLALCTVATGEITQAKTYSGLEFDSLEAVIRHYLKEQDIQVQDACI
AIACPVTEDWVAMTNHTWAFSIKEMQANLGLSHLEVINDFTAVSMAIPMLTPDDVLQFGG
GSAQKDRPIAVYGAGTGLGVAHLVHVNRRWVSLPGEGGHVDFAPNSEEEDSILEVLRAEV
GHVSAERVLSGPGLVNLYRAIVKSDQRLPEKLEPKDITERALADSCIDCRRALSLFCVIL
GRFGGNLALNLGTFGGVYIAGGIVPRFMEFFKASGFRAAFEDKGRFKDYVHDIPVFMITH
AQPGLLGAGAHLRQTLGMHL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacctatgccctcgtaggtgatgttggcgggacgaatgcccgcctggcgttgtgcact
gtggcgacgggtgaaattacccaggcaaaaacctattccggcctggagtttgacagcctg
gaggcggtgatccgccactatctgaaggagcaggatattcaggtgcaggacgcctgcatc
gcgattgcctgtccggtcaccgaagattgggtggcgatgaccaaccacacctgggcgttc
tcgatcaaagagatgcaagccaatctggggcttagccatctggaagtgatcaacgacttt
accgccgtctcgatggcgatcccgatgttgacgccagacgatgtgttgcagttcggcggc
ggcagcgcgcagaaagacaggccgattgcggtgtacggcgcaggcaccggcctgggggtg
gcgcacctggtgcacgttaaccgccgctgggtgagcttgccgggggaaggcggccacgtt
gattttgcgccgaacagcgaagaggaagatagcattcttgaggtgctgcgggcagaagtg
gggcacgtctccgccgagcgcgtgttgtccggcccggggttggtcaatctctaccgcgct
atcgtcaagtccgatcaacgcctgccggaaaagctcgagccaaaggacatcaccgagcgc
gcgctggccgacagttgcattgactgccgccgtgccttgtcgctgttctgcgttatttta
gggcgctttggcggcaacctggcgttgaatctcggcactttcggcggcgtttacatcgcc
ggcggcatcgtgccgcgctttatggagttcttcaaggcatccggtttccgcgcggcgttt
gaagataaagggcgtttcaaggattatgtgcatgatatcccggtctttatgatcacccat
gcacaaccgggcttgttgggcgccggtgcccatctgcgccagacgctgggtatgcatttg
taa

DBGET integrated database retrieval system