KEGG   Serratia sp. AS13: SerAS13_3976Help
Entry
SerAS13_3976      CDS       T02012                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sra  Serratia sp. AS13
Pathway
sra00900  Terpenoid backbone biosynthesis
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01130  Biosynthesis of antibiotics
Module
sra_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SerAS13_3976
Enzymes [BR:sra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SerAS13_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Ad_Cy_reg
Motif
Other DBs
NCBI-ProteinID: AEG29734
Position
complement(4246427..4247623)
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSVGTSTLAVVRENPDRFAIKALVAGRNVAVMAQQCMEFRPAYAAMADEG
AARELRDVLAENGIDTEVMAGEQAACELAALDDVDQVTAAIVGAAGLLPTLAAIRAGKQV
LLANKESLVTCGRLFMDAVQKSQAQLLPLDSEHNAIFQSLPESIQRQLGYSSLVDHGVSR
IVLTGSGGPFRSTPLEQFATMTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAEQMEVILHPQSVIHSMVRYADGSVLAQLGTPDMRTPIAHAMAYPQRVSSGVEALDFC
RIGSLTFAEPERERYPCLYLAIDAFDAGQAATTALNAANEVAVAAFLQEQIRFTDIATVN
QKVVERLSLQEPSCIDAVLEIDRQAREVAVGLVKSLRG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgactattcttggttccaccggctcagtgggaaccagcaccctggccgtg
gtcagggaaaatcccgaccgttttgcgattaaagcgctggttgccggccgcaatgtagcg
gtgatggcgcaacagtgtatggagtttcgcccggcttatgctgcgatggcggacgaaggc
gcggcgcgcgaattgcgcgacgtactggcggaaaacggcattgacactgaggtaatggcg
ggcgaacaggctgcctgtgagttggcggcgctggatgatgtcgatcaggtcactgcggct
attgtcggcgctgccgggctgttgccgacgctggcggcgatccgcgccggcaaacaggtc
ttgttggcgaacaaagagtcgctggtgacctgtggccgtctatttatggatgccgtgcaa
aagagccaggcgcagttattgccactggacagcgaacacaacgcgatttttcagagtttg
cctgaaagcattcagcgtcagttgggatactcttcattagtcgatcatggtgtttcgcgt
attgtgcttaccggttctggcggcccgttccgttcgacgccgctggagcagttcgccaca
atgacgccggaccaggcctgcgctcatcctaattggtctatggggcgcaagatctcggtg
gattccgccaccatgatgaacaaaggactggaatatattgaggcccgttggctgttcaac
gcttcggccgaacaaatggaagtgattctgcacccgcagtcggtgatccactcaatggtg
cgctatgctgatggcagtgtgctggcccagttgggcacgccggatatgcgtacgccaatc
gcccatgcgatggcttacccgcagcgggtcagctctggtgtggaagcgctggatttctgc
cgtatcggttcgttgacctttgccgaacctgaacgggagcgttacccttgcctgtatctg
gcgattgacgcctttgatgccggccaggcggcaaccaccgcgctgaatgcggctaacgaa
gtggccgttgcggccttcctgcaagagcagattcgctttaccgacatcgcgacagtgaac
caaaaagtggtcgaacggctgtctttgcaggaaccgtcctgcattgatgcggtcttagaa
atagatcgccaggcccgtgaagttgccgttgggttagtgaagtcactgcgtggttga

DBGET integrated database retrieval system