KEGG   Serratia sp. AS13: SerAS13_4003Help
Entry
SerAS13_4003      CDS       T02012                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sra  Serratia sp. AS13
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SerAS13_4003
Enzymes [BR:sra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SerAS13_4003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4274893..4276743)
Genome map
AA seq 616 aa AA seqDB search
MIALLEQAQALGVLRPLDLQFARIVAGEEEPDILLAAACLSAEAGAGHVCLMLEQLLPEN
LFEGRQPELAQAVWLAAGQPDLARWQQRLMASAAVGDGSSAMPMVLQQQRLYLQRMWQNE
GEVAEFISSDSIHQAVDEPELHAILDRLFGEATNEPDWQKIAAAVAATRRIAVISGGPGT
GKTTTVAKLLAALVQLADGRRLRIQLAAPTGKAAARLTESLGSAGRQLALTPEQRALFPT
DASTLHRLLGAQPNSQRMRYHRGNPLHLDVLVVDEASMVDLPMMARLIAALPTQARVIFL
GDRDQLASVEAGAVLGDICRFAEQGYSAARAEQLTRLTGCLLQGQSAQAEAAVRDSLCLL
RKSYRFDADSGIGQLAFAVNAGDGKRAAWALSGSFSDVAGYPLAETEDYQALLNACVAGY
GDYLQRVAARADAGEVLAEFGRFQVLCALREGPFGIAGLNERIEAGLQRAGLIQRTPGAL
GRWYPGRPVMIGRNDSALGLFNGDIGIALRDESGELRVHFQLPDGNIKSVQPSRLPAHET
AYAMTVHKSQGSEFDHTVLVLPNHFLPVLTRELVYTAITRARSQLSLYATETVLMRAIRT
PTQRRSGLAERLQITP
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgctactggaacaggcacaggcacttggcgtgctgcgcccgttggacctgcag
tttgcccgtatagtggccggtgaggaagagcctgacattctgctggctgccgcctgcctc
agtgcggaggcaggcgccggtcatgtttgcctgatgctggaacagttactgccggaaaat
ctgtttgaagggcgtcagccggaactggcgcaagccgtgtggctggcggccgggcaaccg
gatcttgcccgctggcagcagcgcctgatggccagtgcggcggtgggtgacggcagcagt
gccatgccgatggtgttgcaacagcagcgtttgtacctgcagcgcatgtggcagaacgaa
ggcgaggtggcggagtttatcagcagcgacagtatccatcaggcggttgatgaacccgaa
ctgcatgccatcctcgatcggctgttcggcgaggcgacgaatgagccggactggcagaaa
attgctgccgcagtggccgcgacgcggcgtattgctgtgatttcaggtgggccgggcacc
ggcaaaaccaccaccgtcgccaaattgctggcggcgctggtacagcttgccgatggcagg
cgcttgcgtattcaactggcggcacccaccggcaaggcggcggcgcgtctgaccgaatcg
ctcggcagcgccggcaggcagttggcgttaaccccggagcaacgcgcgctgttccccacc
gatgcgtcgacgctgcaccgcctgttaggcgctcagcccaatagccagcgcatgcgttat
caccgtggcaacccgctgcatctggatgtgctggtggtggacgaggcttcaatggtcgat
ctgccgatgatggcgcgtctgattgccgcattgcccactcaggcgcgggtgattttcctt
ggcgacagggatcaactggcgtcggtagaggccggtgctgtactgggggatatctgccgt
tttgccgagcagggatacagtgctgctcgtgcggaacaactcacccggctgacaggctgc
ctgttgcaggggcaaagtgcgcaggcggaagcggcggtgcgagacagcctgtgcctgctg
cgcaaaagctatcgttttgatgccgattcgggcattggtcaattggcttttgcggtgaat
gccggtgacggtaagcgtgcggcttgggcactcagcggcagtttcagtgacgttgcgggt
tacccattggcagaaacggaggactatcaggccctgctgaacgcctgtgtagcaggctac
ggtgattatttgcagcgggtcgctgccagggcggatgcgggagaggtgctggcggagttt
ggccgtttccaggtgctgtgcgcgctgcgcgaagggccattcggtatcgccgggctgaac
gagcgtatcgaggcgggattgcaacgggccgggctgatccagcgtacgccaggggccttg
gggcgttggtatcccggtcgtccggtgatgattggccgcaacgacagtgcgttggggctg
tttaacggcgatatcggtatcgctctgcgtgatgagagcggcgagctgcgcgtgcacttc
caactgccggacggcaacatcaagtcggtgcaaccgagccgtttaccggcgcatgaaacc
gcctatgcaatgacggtgcacaagtctcagggatcggagtttgatcatacggtgctggtg
ttgcccaatcacttcttgccggtactgacccgcgaactggtgtataccgccatcacccgc
gcgcgtagccagctttcgctgtatgccaccgagaccgtgctgatgcgggcgatccgcacg
ccaacccaacgccgcagcgggttggcggagcgcttgcagataacgccataa

DBGET integrated database retrieval system