KEGG   Serratia sp. AS13: SerAS13_4243Help
Entry
SerAS13_4243      CDS       T02012                                 

Definition
Glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sra  Serratia sp. AS13
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SerAS13_4243
   00330 Arginine and proline metabolism
    SerAS13_4243
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SerAS13_4243
Enzymes [BR:sra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SerAS13_4243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4538428..4539351)
Genome map
AA seq 307 aa AA seqDB search
MVTTLDNALLDDILQQVRPLIGKGKVADYIPALAEVAADRLAIAVCTVDGEMFQAGDATE
RFSIQSISKVLSLTLALTRYQEHEIWQRVGKEPSGLPFNSLLQLEMEQGKPRNPFINPGA
LVVCDMLQTRLSAPKQRMLEVVRQLTGVDDLAYDSRVARSEFEHSDRNAAIAYLMKSFGN
FENDVLTVLQTYFHYCALRMSCVELARSFAYLANHGRDLSGREVISPLQARQINALMMTS
GMYDGAGEFAYRVGMPGKSGVGGGIVAIVPDELSIAVWSPELDASGNSLAGTAALELLSQ
RISRSIF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacgacattggataacgcgttgctggatgacatcctgcaacaggtgcgcccgctg
attggtaaagggaaagtggcggactatataccggcgctggcggaagtagccgccgaccgt
ctggcgatcgccgtttgcaccgtcgacggcgagatgttccaggctggggatgccacggag
cgtttctctattcagtccatttccaaagtgctgagcctgacgctggcgctgacgcgctac
caggaacacgagatctggcaacgggtcggtaaagagccttccggcctgccgttcaactcg
ttgctgcagctggaaatggaacagggcaagccgcgcaatccgtttatcaatcccggcgcg
ctggtggtgtgcgacatgctgcaaacccggctcagcgcccctaaacagcggatgctggaa
gtggtgcggcaactgaccggcgtagacgatctggcctatgattcccgcgtggcgcgctcc
gagttcgaacactccgatcgcaacgcggcgatagcctatctgatgaagtcgttcggcaac
ttcgaaaacgacgtgctcaccgttttgcaaacctatttccactactgtgcgctgcgcatg
agctgcgtggagctggcgcgcagctttgcctacctggccaatcacgggcgtgaccttagt
gggcgcgaagtgataagcccgctgcaagcccgccagatcaatgcgctgatgatgaccagc
ggcatgtacgacggcgcgggggagtttgcttatcgagtgggcatgccgggcaaatccggc
gtgggcggcggcattgtcgctatcgtgcccgatgagttgtcgatcgccgtctggtcgccg
gagctggatgcatccggtaactccctggcgggaactgcggcgctggaactgttgtctcaa
cggattagccgttcgattttttaa

DBGET integrated database retrieval system