KEGG   Serratia sp. AS13: SerAS13_4250Help
Entry
SerAS13_4250      CDS       T02012                                 

Definition
2-methylcitrate synthase/citrate synthase II (EC:2.3.3.5)
Orthology
K01659  
2-methylcitrate synthase [EC:2.3.3.5]
Organism
sra  Serratia sp. AS13
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SerAS13_4250
Enzymes [BR:sra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.5  2-methylcitrate synthase
     SerAS13_4250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4544903..4546069)
Genome map
AA seq 388 aa AA seqDB search
MTETTPQQTPSGNKPKKSVALSGVVAGNTALCTVGRNGNDLHYRGYDILELAHYCEFEEV
AYLLIHGKLPTRHELDAYKVKLKALRDVPMNVKTVLEALPAASHPMDVMRTGVSALGCVL
PEKDAHGTPGARDIADKLLASLGSMLLYWYHYSHNGKRIETETDDDSIGGHFLHLLHGAK
PTESWEKAMHASLVLYAEHEFNASTFTGRVIAGTGSDIYSAIAGAIGALRGPKHGGANEV
SLEIQQRYETPEEAETDIRRRIENKEVIIGFGHPVYTLADPRHQVIKRIAHQLSQEAGQS
KLFNIADRLESVLWETKKMFPNLDWFSAVSYNMMGVPAEMFTPLFVIARVTGWSAHIIEQ
RLDNKIIRPAAAYIGPEERAFVPLDQRQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacagagacaacgccccaacagacaccgtcaggcaataaaccgaaaaaatccgttgcc
ttatctggcgtggtcgcgggcaataccgcgctgtgtaccgtgggcagaaacggcaacgat
ttgcactaccgcggttatgacattctcgagctggcgcattattgtgaatttgaagaggtg
gcttatttgctgatccacggcaaattgcccacccggcacgagctggacgcttataaggtc
aagctaaaagcgctgcgtgacgtgccgatgaacgttaaaacggtgctggaagcgctgccc
gccgcctcgcatccgatggacgtcatgcgtaccggtgtctccgcattgggctgcgttttg
ccggagaaagatgcgcatggcaccccgggcgcccgcgatattgccgacaaactcctggcc
tcgctcggttccatgctgctgtactggtatcactatagccacaacggcaaacgcattgag
acggaaacggatgacgactcgattggcggccatttcctccatttgctgcatggcgccaag
cccacggaaagctgggaaaaggcgatgcacgcctcgctggtgctctacgccgaacatgag
ttcaacgcttctacctttactggccgggtcattgccggtacaggttcggacatttattcg
gcgattgccggcgccattggcgcgctgcgtggccctaaacacggcggtgccaatgaagtc
tctctggaaatccagcagcgttatgaaacgccggaagaggcggagaccgacatccgcaga
cgcatcgaaaacaaagaggtgatcatcggttttggccacccggtgtataccctcgccgat
ccccgccatcaggtcatcaaacgcattgcacatcagttgtcgcaggaggcggggcagtcg
aagctgttcaatatcgccgaccgattggagagcgtgctgtgggaaaccaaaaaaatgttc
cctaacctcgattggttctcggcggtctcttacaacatgatgggcgtgcccgctgaaatg
ttcacgccgctgtttgtcatcgcccgcgttaccggttggtcggcgcatattattgagcag
cgcctcgacaacaagattatccggcccgcggcggcctatatcggcccggaggaacgcgct
tttgtgcccctcgatcagcgtcaataa

DBGET integrated database retrieval system