KEGG   Serratia sp. AS13: SerAS13_4724Help
Entry
SerAS13_4724      CDS       T02012                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sra  Serratia sp. AS13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sra00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5091230..5093320)
Genome map
AA seq 696 aa AA seqDB search
MDRKRIDQAAAQAGIAADYINAHGKQQAIAEETKRKLLEAMGRSAAPLEAAVTPLPEVKV
FYQGAPVALPLAGSGEYLWTLLREDGGRQQGRASARKTLTLPGELPAGYHQLTLTQDERQ
WQCRLIVAPKRCFEPDALLTGQKLWGACVQLYTLRSDRNWGIGDFGDLRQMVEQVGERGG
AFVGLNPIHALYPANPESASPYSPSSRRWLNVVYIDVNAVEEFQRSDAAQKWWLKPATQK
QLTKARSSEQVDYSTVTQLKLAALKLAFPLFQGRKAGDEQRQAFEQFVVDGGASLYQQAA
FDALHAHLAAADGSLWGWPAWPEQYRQGDSAAVKQFCRQQQDSVTFYLWLQWLAASQFAD
CFRLSQQQQMPIGLYRDLAVGVAEGGSETWCEPDLYCLKASVGAPPDILGPLGQNWGLPP
MDPHVMAARGYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGETADHGAYVKYPVDD
LLAVLALESQRHRCMVIGEDLGTVPVEIVAKLRDSGVYSYKVLYFERDGENHFRAPQAYP
VQAMATITTHDLPTLRGYWQSGDLQLGNQLGLYPDAEILKALFADRERAKQGLLDGLHHY
GCVPQKVGKKAALLNMSPLLNRGLQRYVADSASALLGLQPEDWLDMAEPVNIPGTSDQYP
NWRRKLNKTLEEMFADQQVNRLLKDLDKRRRKVSVG
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcaagcgcatcgatcaggcggccgctcaggcgggtattgccgctgattatatt
aacgctcatgggaaacagcaggcgatcgcggaggagaccaagcgcaagctgctggaggcc
atggggcggagtgccgcaccgctggaggctgcggtgacgccgctgccggaggtcaaggtg
ttctatcagggcgcgccggtggcgttgccgcttgcgggcagcggcgagtatctctggact
ctgctgcgtgaagacggtggccggcaacaggggcgcgccagcgcgcgtaaaacccttacc
ctgccgggcgagttgccggcgggttatcaccaactgacgctgacccaggacgaacggcag
tggcagtgccggttgattgttgcgccgaaacgctgctttgagccggacgcgctgctgacc
ggacaaaagctgtggggcgcttgcgtccagctttacaccctgcgctccgatcgtaactgg
ggtatcggcgattttggcgatctgcggcagatggtggagcaggttggagaacggggaggc
gcttttgtcgggctgaacccgatccacgcgctgtatccggcgaacccggaaagcgccagc
ccgtacagcccgtcatcgcgacgctggctgaacgtggtgtatatcgatgtgaacgcggtg
gaagagttccagcgtagcgatgcggcgcaaaaatggtggctgaaaccggccacgcaaaaa
cagctgaccaaagcgcgcagcagcgaacaggtggattacagcacggtgacgcagctcaag
ctggcggcgctgaagctggcgttcccgttgttccaggggcgtaaagccggtgacgaacag
cgtcaggcgttcgagcagttcgttgtcgacggtggcgccagtctgtatcagcaggcggca
tttgacgcattgcatgctcatcttgccgccgctgacggcagcctgtggggttggccggcc
tggcctgagcaatatcggcagggcgacagcgccgcagtgaagcagttttgccggcaacag
caggattcggtgaccttctatctgtggttgcagtggttggccgccagccagtttgccgac
tgtttccgcctgagccaacaacagcaaatgccgattggcctgtaccgtgatttggcggtg
ggcgtggcggaaggcggttcggaaacctggtgcgagccggatctttattgcctgaaagcg
tcggttggcgcgccgccggacattctgggcccgctgggacaaaactgggggctgccgccg
atggatccgcacgtgatggcggcgcggggttaccagccgtttatcgacctgttgcgcgcc
aatatgaccagttgcggtgcgctgcgcattgaccacgtaatggcgctgctgcgcctgtgg
tggatcccctacggcgaaaccgccgaccatggcgcttacgtgaaatacccggtggatgac
ctgttggcggtgttggcgctggagagccagcgtcaccgctgtatggtgattggcgaagac
ctcggtaccgtgccggtcgagattgtcgccaagctgcgtgacagcggcgtctattcttat
aaggtgctgtatttcgagcgtgacggcgagaaccacttccgtgcgccgcaggcctacccg
gtgcaggcgatggcgaccatcaccacgcatgacctgccgacgctgcgcggttattggcag
agcggcgatctgcagctgggcaaccagctggggctgtatccggatgcggagatcctgaaa
gcattgtttgccgatcgtgaacgcgccaagcaggggttgctggacggattgcatcattat
ggctgtgtgccgcagaaggtgggcaagaaggcggcgttgctgaacatgagcccgctgctg
aaccgtggcttacagcgctatgttgccgacagcgccagcgcactgctgggcctgcagccg
gaagactggctggacatggcagaaccggtcaatattcccggcaccagcgatcagtaccca
aactggcggcgtaaactgaacaaaacgcttgaggagatgtttgccgatcagcaagttaac
cggctgctgaaggatttggacaagcggcggcgcaaggtgtcggtagggtga

DBGET integrated database retrieval system