KEGG   Serratia sp. AS13: SerAS13_4777Help
Entry
SerAS13_4777      CDS       T02012                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sra  Serratia sp. AS13
Pathway
sra00220  Arginine biosynthesis
sra00330  Arginine and proline metabolism
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
sra01130  Biosynthesis of antibiotics
sra01230  Biosynthesis of amino acids
Module
sra_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SerAS13_4777
   00330 Arginine and proline metabolism
    SerAS13_4777
Enzymes [BR:sra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SerAS13_4777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEG30529
Position
complement(5155484..5156389)
Genome map
AA seq 301 aa AA seqDB search
MHIILAPTNLGLSPLRPGHVPGTWRAPQALMAQGLAQRLGAGAVTELPQLIYSPAAQPGT
RIRNGHAIRAFTLALAAEVAAAQAHGEFPLVVGGDCSILLGALAGSRSAGPLSLVHIDGH
SDFRHPGNYDPQQMLGAVAGMDLALATGRGEPLLTEWPGVAGPLVPERQVLQLGERECRD
ADFAWPDINQTAIARIDVFAANRMGKAEIVRQIEQMLATEPEWRFWLHLDVDVLDQTIMP
AVDSPGGPGIDRLWLENIVARLLQNPLCCGMTLSVFDPELDPDGRYAALIVEMLEAMFRS
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcattcttgcacctaccaatctggggctgagccccttgcgaccgggccatgtt
cccggaacctggcgagcgccgcaggcgctgatggcacagggtttggcgcaaaggttggga
gcgggggccgtcaccgagttgccgcaactgatctattcgccggcagcgcagcccggtacc
cgcatacgtaatggtcatgcgattcgcgccttcactctcgcgttggccgcagaggttgct
gcggcgcaggcgcacggcgagttcccgctggtggtcggcggcgattgttcgattctgctg
ggggcgctagccggttcacgcagtgcggggccgctttcgctggtacacatcgacgggcac
agcgatttccgtcatcccggcaactatgatccgcagcagatgttgggtgcggtggcgggg
atggatttggcgttggcgaccgggcgcggggaaccgctgctgaccgaatggcctggcgta
gcagggccgttggtgccggagcggcaggttttacagctgggcgagcgtgagtgccgggac
gcggattttgcctggccggatatcaatcaaacggcaattgcgcgcattgacgtcttcgcc
gccaaccggatgggcaaagcggaaattgtgcggcaaatcgaacagatgctggccaccgag
ccggaatggcgcttttggctgcatctggatgtggacgtgctcgatcaaaccattatgccg
gcggtggattcccccggtggccccggaatcgatcgcctctggctggaaaatatcgtggcg
cggttgctgcaaaatccgttgtgctgcggcatgacgctgtcggtattcgaccccgagctc
gatcccgacggccggtacgcggcgctgatagtggaaatgctggaggcgatgttccgctcc
cgctga

DBGET integrated database retrieval system