KEGG   Serratia sp. AS13: SerAS13_4777Help
Entry
SerAS13_4777      CDS       T02012                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sra  Serratia sp. AS13
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sra01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sra00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5155484..5156389)
Genome map
AA seq 301 aa AA seqDB search
MHIILAPTNLGLSPLRPGHVPGTWRAPQALMAQGLAQRLGAGAVTELPQLIYSPAAQPGT
RIRNGHAIRAFTLALAAEVAAAQAHGEFPLVVGGDCSILLGALAGSRSAGPLSLVHIDGH
SDFRHPGNYDPQQMLGAVAGMDLALATGRGEPLLTEWPGVAGPLVPERQVLQLGERECRD
ADFAWPDINQTAIARIDVFAANRMGKAEIVRQIEQMLATEPEWRFWLHLDVDVLDQTIMP
AVDSPGGPGIDRLWLENIVARLLQNPLCCGMTLSVFDPELDPDGRYAALIVEMLEAMFRS
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcattcttgcacctaccaatctggggctgagccccttgcgaccgggccatgtt
cccggaacctggcgagcgccgcaggcgctgatggcacagggtttggcgcaaaggttggga
gcgggggccgtcaccgagttgccgcaactgatctattcgccggcagcgcagcccggtacc
cgcatacgtaatggtcatgcgattcgcgccttcactctcgcgttggccgcagaggttgct
gcggcgcaggcgcacggcgagttcccgctggtggtcggcggcgattgttcgattctgctg
ggggcgctagccggttcacgcagtgcggggccgctttcgctggtacacatcgacgggcac
agcgatttccgtcatcccggcaactatgatccgcagcagatgttgggtgcggtggcgggg
atggatttggcgttggcgaccgggcgcggggaaccgctgctgaccgaatggcctggcgta
gcagggccgttggtgccggagcggcaggttttacagctgggcgagcgtgagtgccgggac
gcggattttgcctggccggatatcaatcaaacggcaattgcgcgcattgacgtcttcgcc
gccaaccggatgggcaaagcggaaattgtgcggcaaatcgaacagatgctggccaccgag
ccggaatggcgcttttggctgcatctggatgtggacgtgctcgatcaaaccattatgccg
gcggtggattcccccggtggccccggaatcgatcgcctctggctggaaaatatcgtggcg
cggttgctgcaaaatccgttgtgctgcggcatgacgctgtcggtattcgaccccgagctc
gatcccgacggccggtacgcggcgctgatagtggaaatgctggaggcgatgttccgctcc
cgctga

DBGET integrated database retrieval system