KEGG   Serratia sp. AS13: SerAS13_4954Help
Entry
SerAS13_4954      CDS       T02012                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sra  Serratia sp. AS13
Pathway
sra00230  Purine metabolism
sra01100  Metabolic pathways
Module
sra_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SerAS13_4954
Enzymes [BR:sra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SerAS13_4954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase AAA_18 AAA_22 ABC_tran MMR_HSR1 DNA_III_psi Viral_helicase1 AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: AEG30704
Position
5356837..5357460
Genome map
AA seq 207 aa AA seqDB search
MAQGTLFIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRDSRLGEHHGEHYFFVSKD
EFRRMIEQDAFLEHAEVFGNYYGTSRAAIEQVLSTGVDVFLDIDWQGAQQIRAKMPQARS
IFILPPSKDELGRRLRSRGQDSEEVIAKRMAQAVAEMTHYAEYDYLIVNDDFDLALSDLK
TIIRAERLRLGRQLLRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttttattgtctctgcccccagtggcgcagggaaatcaagtctg
attcaggctttgttaaagacgcaaccgctgtacgacacgcaggtttcggtttcgcacacc
acgcgcgacagccgcctgggtgaacatcacggcgaacattatttcttcgtctcaaaagat
gaattccgccggatgattgagcaggatgcgtttcttgagcatgccgaagtgttcggcaac
tattacgggacctcacgcgccgccattgagcaggtgctgtcgaccggcgtagacgtcttc
ctggatatcgattggcaaggtgcgcagcagatccgcgctaaaatgccgcaggcgcgcagc
atctttattttgccgccgtcgaaggatgaacttggccgccgcctgcgtagccgcgggcaa
gactctgaagaggtgatcgccaaacgcatggcgcaggccgtggcggagatgacgcactac
gcggagtatgattatttaatcgtgaacgatgatttcgatctggccctgtccgatctgaaa
accattattcgcgccgagcgcctgcgtttaggccggcaattactgcggcatgacgcttta
atcagcaaactattggcagactga

DBGET integrated database retrieval system