KEGG   Serratia sp. AS13: SerAS13_4984Help
Entry
SerAS13_4984      CDS       T02012                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sra  Serratia sp. AS13
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sra00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SerAS13_4984
Enzymes [BR:sra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SerAS13_4984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5397488..5398414)
Genome map
AA seq 308 aa AA seqDB search
METGKLVVLGSINADHILNIEQFPHPGETVIGKQYKVAFGGKGANQAVAAGRSGADIAFI
ACIGADDIGERIRLQLATDRIDTQPIEAIADNTTGVALIFVNAEGENVIGIDAGANAAVT
PDYLARYQQRVIEADALLMQLESPLETVMAAARLAKQHQTQVILNPAPARELPDELLALV
DMITPNETEAQRLTGIAIANDDDAARAAQALHDKGIGTVIITLGSRGVWLSENGNGKLVP
GFKVKAVDTIAAGDTFNGALVTALLEGKTMADAVRFAHAAAAIAVTRPGAQPSVPWREEI
DAFLQQQE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggtaagctggtggtgcttggcagtatcaatgccgaccatatcctcaatatt
gagcagtttccccacccgggtgaaacggtgatcgggaaacagtataaggtggcatttggc
ggtaaaggcgcgaatcaggcggtggcggcaggacgcagcggtgcggatatcgcctttata
gcctgcatcggcgcagatgacatcggtgaacgcatccgcctgcaactggcgaccgatcgc
attgatacccaaccgattgaggcgattgccgacaacaccacgggcgtggcgctgattttt
gttaatgcggaaggcgagaacgtgatcggcatcgatgccggcgccaatgccgccgtaaca
cccgactatctggcgcgttatcagcaacgggttattgaagccgatgctttgctgatgcag
ctcgagtcgccgctggaaacggtgatggccgccgctcgcttggcgaagcagcatcaaacg
caggtgattctcaatccggcaccggcgcgtgagctgccggatgaactgttggcgttggtc
gatatgatcacgcccaatgaaacagaagcccagcgcctcaccggcatagctatcgctaat
gatgatgacgcggcgcgtgcggcgcaagccttgcacgataaaggcatcggcacggtgatc
ataacccttggcagccgtggcgtttggttgagtgagaacggcaacggtaagttggtgccc
ggcttcaaggttaaagcggtagacaccatcgctgccggtgataccttcaacggggcgttg
gtgacggcgctactggaaggtaaaactatggcggatgcggtgcgcttcgcccatgcggcg
gcggcgattgcggtaacccgtcccggcgctcagccctccgtaccctggcgtgaagagatc
gacgccttcttgcagcagcaggagtaa

DBGET integrated database retrieval system