KEGG   Candidate division SR1 bacterium RAAC1_SR1_1: P148_SR1C001G0608Help
Entry
P148_SR1C001G0608 CDS       T02946                                 

Definition
Histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
srb  Candidate division SR1 bacterium RAAC1_SR1_1
Brite
Enzymes [BR:srb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     P148_SR1C001G0608
Transfer RNA biogenesis [BR:srb03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    P148_SR1C001G0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
671692..673503
Genome map
AA seq 603 aa AA seqDB search
MLKEDIIYELYQSPSLEKLKELKKNFSQINKLKDLVSNVALIQTYRDLLATGKITANKEV
EQLLKKRSIRSESGIVAVQVLTKPFWCPGNCIFCPNDPEMPKSYIKTEPGAARALLNQFD
PVKQAYNRLKSLNLSGHDTDKIEMIVLGGTWDVYPEDYKIEFIKGLYDACNTFDQLEIDH
QGLDEVQEDKRYKYTITNQDTIKYSKTIEEAIEINETAPHRIIGLTIETRPEYVTDANCQ
LRRKLGVTRLEIGIQSMYDDVLAANKRGHTVAQIETACHKLRQYGFKFCVHIMPGLYKSS
LEKDIGTFQQIYDNPYIKPDEIKFYPTSVIPNTELFNLYKSGEYKPLETEEIAHIIETTL
TTIIPPYTRIKRLIRDIPATEIAAGSNVTNLNQLVHTKLQNEQNQNIKSRYPFFQRLYGD
FTQYATFDEYLASKDEKQTSIIGVAPDLTSSREYISLDTRSREIRHNTNHHEETANLVIR
KYLSSVGAEYFISFEDSLGYLYGFARLLLPKEGSTIDREGLGANTALIRELHVYGNLQSL
KKAAQEQGVQHTGFGKQLMHIAEQIAQSKKYIKLSVISGVGVKQYYEKIGYTKEGTYVVK
KFK
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagaagacatcatatacgaattatatcagtcccctagtcttgaaaagctcaaa
gaactcaagaagaatttttctcaaatcaataaactcaaagacttagtaagtaatgtcgcg
ttgattcaaacctaccgtgatctccttgctacgggcaagattaccgcaaacaaagaagtc
gagcaattactcaaaaagagatccatcagatctgagtcgggaattgttgcggtgcaggta
ctgaccaaacctttctggtgtccaggaaactgtattttctgtcccaacgatcctgaaatg
cccaagagttacatcaagacagaaccaggtgctgccagagctttgctcaaccaatttgac
cccgttaaacaagcgtataatagactcaaatccttgaatttatcaggacatgataccgac
aaaatagaaatgatcgtcctctgagggacgtgggatgtgtacccagaagactacaaaatc
gagtttatcaaaggactctatgatgcctgcaatacctttgatcaattggaaatcgaccac
caaggactcgatgaagtgcaagaagataagagatataaatataccatcaccaaccaagac
accatcaaatactccaaaaccattgaagaagcgatcgaaatcaatgaaaccgctccccat
agaatcatcggattgaccattgaaaccagaccagaatatgtaactgacgccaattgccag
ctccgaagaaaactcggagtaacgagattggaaatagggattcaatctatgtacgatgac
gttttggcagccaataaaagaggtcataccgttgcccaaatcgaaactgcctgccacaaa
ctcagacagtacggattcaagttttgcgtgcatattatgccaggactgtacaagtctagc
ctagaaaaagatatcggaaccttccaacaaatatacgataatccttacatcaaacctgat
gaaatcaaattctatccgacatcagtaattcccaacaccgaactcttcaatctctacaaa
tctggtgaatacaaacctttggaaaccgaagaaatcgcacatattatcgagacaacattg
acgaccattatccctccgtatacgagaatcaagagattgatccgcgatattcctgcaacc
gaaattgccgcaggaagcaacgtaaccaacctcaatcaactcgtccacaccaaattacaa
aacgaacaaaatcagaatatcaaatcacgatatccattctttcaacgcttatatggagac
ttcacacaatacgctacattcgacgaatatctagccagcaaagacgaaaaacaaaccagt
attatcggcgttgcccctgatctcacctcttcgagagagtatatctccttagacacgaga
agcagagaaattagacataataccaatcaccacgaagaaacagctaacttagttattaga
aaatatctcagcagcgtaggcgctgagtactttatcagtttcgaagattcattaggatat
ctctatggatttgccagattattactcccgaaagaaggttcaacgatagaccgagaatga
ttaggcgcaaatactgcactcattagagagcttcacgtctatggaaacctccaatctctc
aaaaaagcagctcaagaacaaggtgtacaacatacaggatttggtaaacaactcatgcac
atcgcagaacaaatcgctcaatcaaaaaaatatatcaaactctcagtcatctcaggagtc
ggagtgaaacaatattatgaaaaaatttgatataccaaagaaggcacatatgttgtgaaa
aaatttaaataa

DBGET integrated database retrieval system