KEGG   Candidate division SR1 bacterium RAAC1_SR1_1: P148_SR1C001G0674Help
Entry
P148_SR1C001G0674 CDS       T02946                                 

Definition
hypothetical protein
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
srb  Candidate division SR1 bacterium RAAC1_SR1_1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:srb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:srb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(731764..733224)
Genome map
AA seq 486 aa AA seqDB search
MNLQELIASLNPHQAAYINMDLKDPRNGDYMLAAFHLIPGGKLNILQAACEAAAESSTGT
NFLVQTETAYSKMLNALVYKIDLEKNLVWIAYPWRLFDRGGNVQNILTYIAGNVFGMKEV
AAFKLLDVRFPAAMLEQYDGPSYTLDDMRAYLNVYDRPILGTIVKPKMGLTSAEYAEVAY
DFRVGGGDFVKNDEPQADQDFCPYDKMVAHIKEAMDKAVKETGKKKVHSFNVSASDYDTM
IKRCELIVNSGMEKGSYAFLIDGTTAGWMAVQTLRRKYPDVFIHFHRAGHGAFTRPENPI
GYTVLVLSKFARLAGASGIHTGTAGVGKMAGTPEEDVTAAHSIFGLDAPGHIFQQSWGTI
PENDVDWLQKVQEDHHQHLTKEDDTWRNLKKCCPIISGGLNPTLLKPFIDVMGDVDFITT
MGAGCHAHPRGTKAGATALVQSCEAYKQGINIAEYAKDHVELAEAIEFFTKKENKDVRHA
ERRESN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaagaacttattgcaagtttaaatccccatcaggcggcatatatcaatatg
gatcttaaagatccgagaaatggtgattatatgttggctgctttccatttgattcctggg
ggaaaattaaatattttgcaagcggcatgtgaagcagctgcagaatcaagtacaggaaca
aatttccttgtacaaacagaaacagcatattccaaaatgctaaatgctttggtgtataaa
attgatttagaaaaaaacctcgtttggattgcttatccatggagattgtttgatagagga
ggtaatgtacaaaatattttgacctatattgcaggaaatgtttttggaatgaaagaagtc
gctgcgtttaaattattagatgttcgatttcccgctgcaatgcttgaacaatatgatgga
cctagttataccttggatgatatgagagcttacttgaatgtatatgatagaccgattctt
ggaactattgtaaaaccaaaaatgggacttacttctgctgaatatgctgaagttgcctat
gatttccgagtaggtggaggagattttgtaaaaaatgatgaaccacaggcagatcaagat
ttctgtccttatgataaaatggtagctcatatcaaagaagctatggataaggcagtgaaa
gaaacaggaaagaaaaaagtacattcctttaacgtgtcagcgtctgattatgatactatg
atcaaaagatgtgaactgatcgttaattcaggcatggaaaaatgatcatatgcgtttttg
attgatggaacaactgcaggatggatggcagttcaaacccttagaagaaaatatcctgat
gtatttattcatttccatagagcaggtcatggagcatttacaagaccagaaaatcctatc
ggatatacggtcttagtgttgtctaagtttgctagactagctggggcgtcaggtattcat
acggggacagctggtgtgggtaaaatggctggaactccagaagaagacgtaactgcagca
catagtatattcgggctagacgccccaggacatatctttcaacaatcatggggaaccatt
ccagaaaatgatgttgattggcttcaaaaagtacaagaagatcatcatcaacatcttacc
aaagaagatgatacttggagaaatctcaaaaaatgttgcccaattatctctggaggactc
aatccaacacttttgaaaccgtttattgatgtgatgggagatgtagactttattacgact
atgggagcgggttgtcatgctcatccaagaggtacgaaggctggagcaacggctttggta
caatcatgtgaagcatataaacaaggtattaatattgctgaatatgcaaaagatcatgta
gaattggctgaagctattgaattttttaccaaaaaagaaaacaaagacgttagacatgcg
gaaagaagagaatctaattaa

DBGET integrated database retrieval system