KEGG   Streptomyces rapamycinicus: M271_04895Help
Entry
M271_04895        CDS       T02907                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
src  Streptomyces rapamycinicus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M271_04895
   00500 Starch and sucrose metabolism
    M271_04895
Enzymes [BR:src01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     M271_04895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1236560..1237633
Genome map
AA seq 357 aa AA seqDB search
MTLSPRRPRRRRPAPLIGSLALATGVGLAVAPAHAATPIAAAATIVVAKDGSGTYTTVQA
AVDAVPANNPSAVTISIKPGTYRETVKVPANKPHIRLVGTTSSKNDVTIVYNNASGTPKP
GGGTYGTSGSATVAVEADDFQARNLQFVNDFNEGNTSITDKQAVALRTAGDRIVLDNVGA
VGDQDTLLLDSASKDKVGRVYVNNAWIQGNVDFVFGRASAVINKSAIRLVKRYDGSSGGY
VAAPSTAAGKKGFLFINSNITGDVGSRSFYLGRPWHAGGDASLDPQAVVRNTDLSAAVKT
TPWTDMSGFSWKDDRFAEYKNTGAGSGAASTDRPQLTDAQAADYEVADWLGGWQPSS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcagtccacggcgcccccggcgccgccgccccgctccgctcatcggctccctg
gccctggccaccggcgtcgggctcgccgtcgccccggcccacgccgccacgcccatagcc
gcggcggccaccatcgtggtggccaaggacggcagcggcacctacaccaccgtccaggcg
gccgtcgacgcggtaccggcgaacaacccgtccgccgtcaccatctccataaagcccggt
acgtaccgcgagacggtgaaggtccccgccaacaagccgcacatccggctggtggggacc
acgagcagcaagaacgacgtgacgatcgtctacaacaacgcctccggcacccccaagccc
ggcggaggcacctacggcaccagcggcagcgcgaccgtggccgtcgaggccgatgacttc
caggcccgcaatctgcagttcgtgaacgacttcaacgagggcaacaccagcatcaccgac
aagcaggcggtcgcgctgcgcaccgcgggcgaccggatcgtcctggacaacgtcggcgcg
gtcggggaccaggacaccctgctgctggactcggcgagcaaggacaaggtcggccgggtg
tatgtcaacaacgcctggatccaggggaatgtcgacttcgtcttcggccgggcctccgcc
gtgatcaacaagtcggcgatccggctcgtcaagcgctacgacggcagctccggtggctat
gtcgcggcgccctcgacggcggccgggaagaagggcttcctgttcatcaacagcaacatc
accggggatgtcggcagccggtcgttctatctcggccgtccctggcacgcgggcggcgac
gccagtctcgatccgcaggcggtcgttcgcaatacggatctgtcagcggcggtcaagacc
acaccgtggacggacatgagcggcttctcctggaaggacgaccgcttcgcggagtacaag
aacaccggcgccggttccggtgcggcgagcacggaccgtccgcagctgaccgacgcccag
gccgcggactacgaggtcgccgactggctcggcggctggcagccgtcgtcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system