KEGG   Streptomyces rapamycinicus: M271_05065Help
Entry
M271_05065        CDS       T02907                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
src  Streptomyces rapamycinicus
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:src00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:src00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:src00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:src00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1281231..1282490)
Genome map
AA seq 419 aa AA seqDB search
MTNLSPQLRQATPVVAVRGEGAYVDGEDGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQVG
TLIHGQYTTVMHPPLRRLVEKLGEVLPTGLDSLFFSNSGSEAVESALRLARQATGRPNVL
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPTAYRYGWDEETATRFALREL
DYVLQTISPPDDTAAIIVEPVLGEGGYVPATEGFLQGLRERADRHGFLLILDEVQTGVGR
TGRFWGHDHFGIRPDILVTAKGLASGFPLSGIAASEELMSKAWPGSQGGTYGANAVACAA
AAATLDVVREENLVANAEAMGARLRSGLEDVAAKTPAIGDVRGLGLMLASEFVTADGEPD
PATAARVQRAAVDEGLLLLLCGAWNHVVRMIPALVVDEAAIDEGLRAWSAAVQAGTADS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatctgtcgccgcagctccgtcaagccactccggtggtcgccgtccggggagag
ggcgcctacgtcgacggcgaggacgggcggcgatacctcgacttcaccgcgggcatcggc
gtcaccagcaccgggcactgccatccgcgggtcgtcgccgccgcccaggagcaggtgggc
accctcatccacggccagtacacgaccgtgatgcacccgccgctgcggcggctggtcgag
aagctgggcgaggtgctccccacgggcctcgacagtctgttcttcagcaactccggcagc
gaggccgtggagtcggccctgcgcctggcccgccaggccaccggccggcccaacgtcctg
gtctgccacggcggattccacggccgcactgtggccgccgcctccatgaccacctccgga
acccgcttccggtccggtttctcgccgctgatgagcggtgtcgtggtgaccccgttcccc
acggcctaccggtacggctgggacgaggagaccgcgacccggttcgccctgcgggagctg
gactacgtcctgcagaccatctccccgcccgacgacaccgccgcgatcatcgtcgaaccg
gtgctcggcgagggcggctacgtgcccgcgaccgagggcttcctgcagggcctgcgggag
cgggccgaccgccatggcttcctgctgatcctggacgaggtgcagaccggggtgggccgc
accggacggttctggggccatgaccacttcggcatccgtcccgacatcctggtcaccgcc
aaggggctggccagcggcttcccgctgtccggcatcgcggcctccgaggagctgatgagc
aaggcctggcccggctcccagggcggcacctacggcgccaacgccgtggcctgcgcggcc
gccgccgccaccctcgacgtggtccgcgaggagaacctcgtggccaacgccgaggccatg
ggggcgcggctgcgcagcggtctggaggacgtggccgccaagacccccgccatcggcgac
gtgcgcggcctcggcctcatgctggccagcgagttcgtcaccgccgacggcgagccggac
ccggcgaccgcggcccgggtgcagcgcgccgccgtggacgaagggctgttgctgctcctg
tgcggcgcctggaaccatgtggtccggatgatccccgccctcgtcgtcgacgaagcggcg
atcgacgagggtctgcgcgcctggtccgccgccgtccaagccggaacagcggactcctga

DBGET integrated database retrieval system