KEGG   Streptomyces rapamycinicus: M271_06405Help
Entry
M271_06405        CDS       T02907                                 

Definition
DNA lyase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
src  Streptomyces rapamycinicus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:src00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    M271_06405
Enzymes [BR:src01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     M271_06405
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     M271_06405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1684196..1685110)
Genome map
AA seq 304 aa AA seqDB search
MHRSGWFRSGLRHTGGMPELPEVEALSAILAERAAGREVARVLPVAVSVLKTYAPPLSAL
EGRTVTAASRHGKFLDLATDGPHLVVHLAKAGWLRWRDGLPEAPPRPGRGPLALRLLLAG
PERSGFDLTEAGTRKGLAVYVVGDPREVPGIARLGPDPLDDSFTLEAFAGLLRGVRHRIK
GVLRDQSVIAGIGNAYSDEILHAARMSPYRLASDLTEAEIAGVYEAMGTTLRSAVERSRG
LAATDLKGEKRGGMRVHGRAGQPCPVCGDTVREVSFRDSALQYCPTCQTGGKPLADRRLS
RLLK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgctccgggtggttccgctccggcctgcggcacactggtggcatgccggagctg
cccgaggtggaggccctcagcgcgatcctggccgagcgtgccgccggccgggaggtcgcc
cgcgtcctccccgtcgcggtgagcgtcctgaagacctacgccccgccgctgagcgcgctg
gagggccgcaccgtcacggccgcgtcccgccacggcaagttcctcgacctggcaaccgac
ggcccccatctggtggtccacctcgccaaggcgggctggctgcgctggcgggacgggctc
cccgaggccccgccccggcccggcaggggcccgctcgcgctgcggctgctcctggccggt
cctgagcgctccggcttcgacctcaccgaggccgggacgcgcaaggggctcgcggtgtac
gtggtcggtgacccgcgggaggtccccgggatcgcccggctgggcccggacccgctggac
gactccttcaccctggaggcgttcgccgggctgctgcgcggtgtgcgccaccggatcaag
ggggtgctgcgcgaccagagcgtcatcgccgggatcggcaacgcctactccgacgagatc
ctgcacgccgcccggatgtcgccctaccggctcgcctcggacctcaccgaagcggagatc
gccggggtgtacgaggcgatgggcaccacgctgcgctccgccgtcgagcgctcccgcggc
ctggccgccaccgacctcaagggggagaagcgcggcggtatgcgggtgcacggccgcgcc
gggcagccgtgcccggtgtgcggggacaccgtccgcgaggtgtccttccgcgactccgcg
ctgcagtactgccccacctgccagaccggcggcaagccgctcgccgaccggcggctgtcc
cggctgctcaagtag

DBGET integrated database retrieval system