KEGG   Streptomyces rapamycinicus: M271_13385Help
Entry
M271_13385        CDS       T02907                                 

Definition
aminotransferase class III
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
src  Streptomyces rapamycinicus
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M271_13385
   00650 Butanoate metabolism
    M271_13385
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M271_13385
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M271_13385
Enzymes [BR:src01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     M271_13385
Amino acid related enzymes [BR:src01007]
 Aminotransferase (transaminase)
  Class III
   M271_13385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3472632..3473984)
Genome map
AA seq 450 aa AA seqDB search
MSSDINDAKSGPHATLHARHQAVLPDWLAVYYQRPIEITHGEGRHVWDAEGNRYLDFFGG
ILTTMTAHALPEVTKAISEQAGRILHTSTLYLDRPMVDLAERVAALSGIPDARVFFTTSG
TEANDTALLLATTYRRSNQILAMRNSYHGRSFSAVGITGNRGWSPTSLSPLQTLYVHGAV
RTRGPFAGLSDGEFIKACVADLEDVLGQAHGNVAALIAEPIQGVGGFTSPPDGLFAAFRE
VLDRHGILWITDEVQTGWGRSGDHFWGWQAHDGSGPPDILTFAKGIGNGMSIGGVVARAE
VMNCLGANSISTFGGSPITMAAGLANLNHLVEHDLQGNARRVGGLLIERLRAACAGLDGV
REVRGRGLMIGIELVDPGTGEPSPEGASAVLEAAREGGLLIGKGGGHNSSVLRIAPPLSL
TVAEAEEGAEILEAALKSALETTWSGRSAS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgacatcaacgacgccaagagcggtccccacgccaccctccacgcccgccac
caggccgtactccccgactggctcgccgtctactaccagcgccccatcgagatcacccac
ggcgagggacgccatgtctgggacgccgagggcaaccgctacctcgacttcttcggcggc
atcctcaccacgatgaccgcccatgccctccccgaggtcaccaaggcgatcagcgagcag
gccggccggatcctgcacacctccacgctctacctcgaccggcccatggtcgacctggcc
gagcgggtcgccgcgctgtccggcatcccggacgcgcgggtcttcttcaccacctccggc
accgaggccaacgacacggccctgctgctcgccacgacgtaccgccgctccaaccagatc
ctggcgatgcgcaacagctaccacggccgctccttctcggccgtcggcatcaccggcaac
cgcggctggtcgccgaccagcctgtccccgctgcagacgctgtacgtacacggcgcggtg
cgcacccggggaccgttcgccgggctgtcggacggcgagttcatcaaggcgtgcgtggcc
gacctggaggacgtactcggccaggcgcacggcaatgtcgccgcgctgatcgccgagccg
atccagggcgtcggcggcttcacctccccgcccgacgggctgttcgccgccttccgcgag
gtgctcgaccggcacggcatcctgtggatcaccgatgaggtgcagaccggctggggccgc
agcggcgaccacttctggggctggcaggcgcacgacggctccgggccgcccgacatcctc
accttcgccaagggcatcggcaacggcatgtcgatcggcggtgtcgtcgcccgcgccgag
gtcatgaactgcctgggcgccaactccatctccaccttcggcggcagccccatcaccatg
gccgccggtctggccaacctcaaccacctggtcgaacacgatctccagggcaacgcccgc
cgggtcggcggactgctgatcgagcggctgcgcgccgcctgcgccggtctggacggtgtg
cgcgaggtccgcggccgggggctgatgatcggcatcgagctggtggacccgggcaccggc
gaaccgtccccggagggcgcgtccgccgtgctggaggccgcccgggagggcgggctgctc
atcggcaagggcggcgggcacaacagcagcgtgctgcggatcgccccgccgctcagcctc
accgtcgccgaggccgaggagggcgcggagatcctcgaggccgccctcaagtccgccctg
gagaccacctggtccggaaggagcgcgagctga

DBGET integrated database retrieval system