KEGG   Streptomyces rapamycinicus: M271_14280Help
Entry
M271_14280        CDS       T02907                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
src  Streptomyces rapamycinicus
Pathway
src00860  Porphyrin and chlorophyll metabolism
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M271_14280
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     M271_14280
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     M271_14280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored Pyr_redox FAD_binding_2 Pyr_redox_2 HI0933_like HTH_AsnC-type AlaDh_PNT_C GIDA Lycopene_cycl NAD_binding_7 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGP54444
UniProt: A0A0A0NBV1
Position
complement(3691265..3692800)
Genome map
AA seq 511 aa AA seqDB search
MRAANTPGAGRTGHVVVIGGGIAGLAAAHRLLDGGARVTVLEASGRLGGKLCSGEIEGVP
VDLGAESMLARRPEAVELARAVGLGDRLQPPATATASLWTRGGLRPMPKGHVMGVPGDLE
PLAASGVISEEGLARIARDRELPPTPVGEDVALGGYLAERLGREVVDRLVEPLLGGVYAG
DVYRTSMRASVPTLFEVAQSGRPLTEGVRELAERSARRQDGPVFMGIDGGIGRLPLAVAD
AVRAAGGEIRTGAPVRELRRTADGWTVVVDGAGGAGGTGGTGGAKGTDGTNGVDGADGPP
VVAADAVVLAVPAPAAARLLAAGAPAASAELATVDYASMALITMAFRRTDMVSLAEGSGF
LVPPVDGRTIKAATFSSRKWGWLRDAGPDLFVLRTSIGRFDDEADLKRDDADLVRMSLGD
LGEAVGLAAKPVASRVDRWDGGLPQYPVGHLDRVARIRAEVAKVPGLAVCGALYDGVGIP
ACVGSARKAADELLGALAGPLEPGAGAGERE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggcgaacactccgggggcggggcgcaccggccatgtcgtggtcatcggcggc
ggaatcgcgggcctcgcggcggcccaccggctgctggacggcggggcgcgggtgacggtc
ctggaggcgtcggggcggctcggcggcaagctgtgctcgggcgagatcgagggcgtaccg
gtcgacctgggcgccgagtcgatgctcgcccgccgcccggaggcggtcgagctggcgcgc
gccgtgggcctcggcgaccggctgcagccgcccgcgaccgcgaccgcctccctctggacg
cgcggcgggctgcgcccgatgcccaagggacatgtgatgggcgtccccggcgatctggag
ccgctggccgcgtccggcgtgatctcggaggagggactggccaggatcgcccgcgaccgc
gagctgccgcccacaccggtgggcgaggacgtggcgctcggcgggtatctggcggagcgg
ctcggccgcgaggtcgtggaccggctggtggaaccgctgttgggcggggtgtacgcgggc
gatgtgtaccgcacctcgatgcgcgcgtcggtccccaccctcttcgaggtggcgcaatcc
ggccgcccgctgaccgaaggcgtccgggagctggccgagcgctccgcgcggcggcaggac
ggcccggtgttcatgggcatcgacggcgggatcgggcggctgccgctcgcggtcgccgac
gccgtacgggccgcgggcggcgagatccgcaccggggcgccggtacgggagctgcggcgc
acggccgacggctggacggtcgtggtggacggcgcgggcggtgcgggcggtacgggcggt
acgggcggcgcgaagggtacggacggcacgaacggcgtggacggtgcggacggcccgccg
gtggtggcggccgacgccgtggtgctggcggtgcccgcgcccgccgccgcgcggctgctg
gccgccggggccccggccgcctccgccgagctggccaccgtggactacgcctcgatggcg
ctgatcaccatggccttccggcgcaccgatatggtctcgctcgccgagggcagcggcttc
ctggtgccgccggtcgacggccggacgatcaaggcggccacgttctccagccgcaagtgg
ggctggctgcgcgacgccggtcccgatctcttcgtgctgcgtacctcgatcgggcggttt
gacgacgaggcggatctgaagcgggacgacgccgatctggtaaggatgtcgctcggcgat
ctcggtgaggccgtcggcctggcggcgaagcccgtcgcgagccgcgtggaccgctgggac
ggcggactgccccagtacccggtgggccatctcgaccgggtcgcccgcatccgcgccgag
gtcgccaaggtgccggggcttgcggtgtgcggcgccctctacgacggggtgggcatcccc
gcgtgcgtcggcagcgcccgtaaggcggccgatgagctgctgggcgccctggcgggcccc
ctggagccgggcgccggagccggagagcgagaatag

DBGET integrated database retrieval system