KEGG   Streptomyces rapamycinicus: M271_16680Help
Entry
M271_16680        CDS       T02907                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
src  Streptomyces rapamycinicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:src00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4282504..4284249
Genome map
AA seq 581 aa AA seqDB search
MIVNEPVPDTFEDTPAGDRDPDWFKRAVFYEVLVRSFQDSNGDGVGDLKGLTAKLDYLQW
LGVDCLWLPPFFASPLRDGGYDVSDYTAVLPEFGDLADFVEFVDAAHQRGMRVIIDFVMN
HTSDQHPWFQESRGDPDGPYGDYYVWADDDKQYQDARIIFVDTETSNWTFDPVRKQYYWH
RFFSHQPDLNFENPAVQEEVLAALRFWLDLGIDGFRLDAVPYLYAEEGTDCENLPRTHEM
LRRVRAEIDAHYPDTVLLAEANQWPEDVVDYFGDFSAGGDECHMAFHFPVMPRIFMAVRR
ESRYPVSEILAKTPAIPSGCQWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMRANIG
IRRRLAPLLDNDRNQIELFTALLLSLPGSPILYYGDEIGMGDNIWLGDRDAVRTPMQWTP
DRNAGFSSCDPGRLFLPTIMDPVYGYQVTNVEAAMSSPSSLLHWTRRMIEIRKQNPAFGL
GSFTELPSSNPAVLAFLREAPRTRDGEDDLVLCVNNFSRFAQPTELDLQSFAGRHPVELI
GGVRFPAIGELPYLLTLAGHGFYWFRLRRSEVVGHWADRVG
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcaacgagcccgtaccggacacgttcgaggacacgcccgcgggtgaccgcgat
cccgactggttcaagcgcgcggtcttctacgaggtcctggtccgctccttccaggacagc
aacggcgacggcgtcggcgacctcaagggcctgacggccaaactggactatctgcagtgg
ctgggcgtggactgcctgtggctgccgccgttcttcgcctcaccgctgcgcgacggcggc
tatgacgtctcggactacaccgccgtactgccggagttcggggatctcgcggacttcgtg
gagttcgtcgacgccgctcatcagcgcgggatgcgcgtgatcattgactttgtcatgaac
cacacgagtgatcagcatccgtggttccaggagtcccgcggcgacccggacggaccgtac
ggcgactactacgtctgggccgacgacgacaagcagtaccaggacgcgcggatcatcttc
gtcgacaccgagacctccaactggacctttgatccagtacgcaagcagtactactggcac
cgcttcttctcgcaccagccggacctcaacttcgagaaccccgccgtccaggaggaggta
ctggccgccctgcgcttctggctggacctgggcatcgacggattccggctcgacgccgtc
ccatatctgtacgccgaggagggcaccgactgcgagaacctgccccggacacatgagatg
ctcaggcgcgtccgggccgagatcgacgcccactatccggacaccgtgctgctggccgag
gccaaccagtggccggaggacgtcgtcgactacttcggcgacttctcggcgggcggcgac
gaatgccatatggccttccacttcccggtgatgccgcgcatcttcatggcggtgcggcgc
gagtcccgctacccggtctcggagatcctcgccaagacccccgccatcccctccggctgt
cagtggggcatcttcctgcgcaaccacgacgagctgacgctggagatggtcaccgacgaa
gagcgcgactacatgtacgcggagtacgccaaggatccgaggatgcgcgccaacatcggc
atccgcagacggctggcgcccctgctggacaacgaccgcaaccagatcgagctgttcacc
gcgctgctgctgtccctgcccggctcgccgatcctctactacggcgacgagatcggcatg
ggcgacaacatctggctcggcgaccgcgacgccgtgcgcacccccatgcagtggaccccc
gaccggaacgcgggcttctcctcctgcgatccggggcggctgttcctgccgaccatcatg
gacccggtctacggctatcaggtcaccaatgtcgaggcggccatgagcagcccgtcctcg
ctgctgcactggacccgccggatgatcgagatccgtaagcagaaccccgccttcggactc
ggctccttcaccgaactgccctcctccaacccggccgtcctcgccttcctgcgcgaggcc
ccgaggacccgggacggtgaggacgacctggtgctgtgcgtgaacaacttctcgcgcttc
gcccagcccaccgagctggacctgcagtccttcgccggccgccatccggtcgagctgatc
ggcggggtccgcttcccggccatcggcgagctgccgtatctgctcaccctggccgggcac
gggttctactggttccggctgcggcgcagtgaggtagtggggcactgggccgaccgcgtc
ggctga

DBGET integrated database retrieval system