KEGG   Streptomyces rapamycinicus: M271_16695Help
Entry
M271_16695        CDS       T02907                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
src  Streptomyces rapamycinicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M271_16695
Enzymes [BR:src01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     M271_16695
Exosome [BR:src04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M271_16695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4286963..4289191
Genome map
AA seq 742 aa AA seqDB search
MARARRSWWRTSGGAAAPALGDEERRRLLAGAHHDPHAVLGAHPVPGGVLFRALRPYARS
VTVAAAGLRARLRAEGDGLFSGVLPLREVPDYRLLVAYEDAELELHDPYRFLPAIGELDL
HLIGEGRHEELWRALGARPMTHQGVAGTRFTVWAPNALGVRLTGDFTYWDGTALPMRSLG
GSGVWELFLPGVGEGALYKFEIARPDGGHSLRADPMARRTECPPATASVVHASHHAWGDE
AWLARRKSGRVHELPFSVYEVHLPSWRPGLTYRQLAEQLPAYVRDLGFTHVELMPVAEHP
FGGSWGYQVTGFYAPTARLGTPDDFKYLVDALHRAGIGVIVDWVPAHFQDAWALAEFDGR
PLYEPADPLRAAHPDWGTLEFDYGRTEVRNFLVANAVYWCEEFHIDGLRVDAVASMLYLD
YSREPGQWTPNAHGGRENLDAVAFLQEMNATVYRRCPGVVTIAEESTAWDGVTRATHHVG
PSGFGGLGFGLKWNMGWMHDSLAYLAHEPVHRAYHHHEMTFSMVYAYSENYVLPISHDEV
VHGKRALVSKMPGDWWQRRATHRAYLGFMWAHPGKQLLFMGQEFAQGAEWSEAHGPDWWL
LDPSYSAEPDHRGVRDLVRDLNQAYAATPALWQRDTDPEGFSWVEGDAREDNVFAFLRYD
AEGSPLLAISNFSPVVRHEYRVGAPDAVPVWREVLNTDDRRYGGGGVVNAEPLKAEPTGW
HGRPASILPVLPPLGTIWLRPA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgggcccgacgatcgtggtggaggacgagcgggggtgcggccgcgcccgcgctg
ggggacgaggagcggcggcggctgctggccggggcgcatcacgatccgcacgcggtgctc
ggcgcccaccccgtgccgggcggggtgctgttccgggccctgcgcccgtacgcccggtcg
gtgaccgtcgccgccgccgggctgcgcgcccggctgcgggccgagggggacgggctgttc
tccggggtgctgccgctgcgggaggtcccggactaccggctgctggtggcgtacgaggac
gccgagctggagctgcacgacccgtaccgcttcctgcccgccatcggcgagctcgatctg
cacctcatcggcgagggccgccacgaggagctgtggcgggcgctcggcgcacggccgatg
acccaccagggggtggcgggcacccgcttcaccgtatgggcgcccaatgccctcggggtg
cggctgaccggcgacttcacctactgggacggcaccgcgctgccgatgcgctcgctcggc
ggcagcggcgtgtgggagctgttcctgcccggcgtcggcgagggcgcgctctacaagttc
gagatcgcccggcccgacggcggccactcgctgcgcgccgatccgatggcgcggcgtacc
gagtgcccgcccgccaccgcctccgtcgtccacgcctcgcaccacgcctggggcgatgag
gcgtggctggcgcggcggaagagcggacgcgtccatgagctgccgttctccgtctacgag
gtgcatctgccgtcctggcggccggggctgacctaccggcagctcgccgagcagctcccg
gcgtacgtcagggacctgggcttcacccatgtcgagctgatgccggtggccgagcacccc
ttcggtggctcctggggctaccaggtgaccggcttctacgcgcccacggcccggctcggc
acccccgacgacttcaagtacctggtggacgcgttgcaccgggcgggcatcggggtcatc
gtggactgggtgcccgcgcacttccaggacgcctgggcgctggcggagttcgacggccgt
ccgctgtacgagcccgccgatccgctgcgggccgcgcaccccgactggggcacgctggag
ttcgactacgggcgcacggaagtgcgcaacttcctggtggcgaacgcggtctactggtgc
gaggagttccacatcgacggtctgcgcgtggacgccgtcgcctccatgctctacctcgac
tactcccgcgagccgggccagtggacgcccaacgcgcacggcggccgggagaacctggac
gcggtcgccttcctccaggagatgaacgcgaccgtctaccgccgctgtccgggcgtggtc
accatcgccgaggagtcgaccgcgtgggacggggtcacccgcgccacccaccatgtgggc
cccagcggcttcggcggcctcggtttcgggctgaagtggaacatggggtggatgcacgac
tcgctggcctatctcgcgcacgagccggtgcaccgcgcctatcaccaccacgagatgacg
ttctcgatggtgtacgcgtacagcgagaactatgtgctgccgatctcgcacgacgaggtg
gtgcacggcaagcgggccctggtgtcgaagatgcccggcgactggtggcagcggcgcgcc
acccaccgcgcctacctcggcttcatgtgggcccacccgggcaagcaactgctgttcatg
ggccaggagttcgcgcagggcgccgagtggtcggaggcgcacggtccggactggtggctg
ctggacccgtcgtactccgccgagcccgaccaccggggcgtccgcgatctggtccgcgac
ctcaaccaggcctacgcggccacgcccgcgctgtggcagcgggacaccgatcccgagggc
ttctcctgggtggagggcgacgcccgcgaggacaatgtcttcgccttcctccgctacgac
gccgagggctccccgctgctggccatcagcaacttctccccggtggtccgccatgagtac
cgcgtcggggcgccggatgcggtgccggtgtggcgcgaggtgctgaacaccgacgaccgg
cgctacggcggcggtggcgtggtcaacgccgagccgctgaaggccgagcccacggggtgg
cacggccgtccggcctccatcctgccggtgctgccgccgctggggacgatctggctgcgg
cccgcctga

DBGET integrated database retrieval system