KEGG   Streptomyces rapamycinicus: M271_17630Help
Entry
M271_17630        CDS       T02907                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
src  Streptomyces rapamycinicus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M271_17630
   00330 Arginine and proline metabolism
    M271_17630
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    M271_17630
Enzymes [BR:src01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     M271_17630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4496695..4497606)
Genome map
AA seq 303 aa AA seqDB search
MDYQAVLEEVAAHVRPRIGRGRVAQYIPALASVDADRFGIALADVDGRVTGVGDWERPFS
MQSISKAFSLALVLADDGEKLWRRVGREPSGNPFNSLVQLEYEHGIPRNPFINAGALVVT
DRLHTLTGDASTTMLDFLRAESGNPDLAFDQEVAVSETAHGDRNAALAHFMAGYGNLDNP
VPTVLEHYFWQCSIEMSCRDLALAGGFLARHGLRADGSRLLSRSEAKRVNAVMLTCGTYD
AAGDFAYRVGLPGKSGVGGGIVAVVPGRCTLCVWSPGLDDRGNSVAGVAALDHFTTLTGW
SVF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggactaccaggcagtgctggaggaggtcgcggcccatgtgcggccgcggatcggccgg
ggccgggtggcccagtacatcccggcgctcgcctcggtggacgcggaccgcttcgggatc
gccctcgccgacgtcgacggccgggtcaccggggtcggcgactgggaacggcccttctcg
atgcagtccatctccaaggcgttcagcctcgcgctcgtcctcgccgacgacggcgagaag
ctgtggcggcgggtcggccgggagccctcgggcaaccccttcaactccctggtgcagctg
gagtacgagcacggcatcccgcgcaatccgttcatcaacgccggggcgctcgtcgtcacc
gaccggctgcacaccctcaccggcgacgccagcaccaccatgctggacttcctgcgcgcc
gagagcggcaacccggacctcgccttcgaccaggaggtcgccgtctccgagaccgcccac
ggcgaccgcaatgccgccctcgcccacttcatggccggatacggcaacctcgacaacccc
gtgccgaccgtcctggagcactacttctggcagtgctcgatcgagatgagctgccgcgac
ctcgccctggcgggcggcttcctcgcccgccacgggctgcgcgcggacggctcccggctg
ctgtcgcgcagcgaggccaagcgggtcaacgcggtcatgctcacctgcggtacgtacgac
gcggcgggcgacttcgcctaccgggtcgggctgcccggcaagagcggggtcggcggtggg
atcgtcgcggtggtgcccgggcgctgcacgctgtgcgtctggagtcccgggctcgacgac
cgcggcaactcggtggccggggtggcggccctggaccacttcaccacgctgaccggctgg
tccgtcttctag

DBGET integrated database retrieval system