KEGG   Streptomyces rapamycinicus: M271_19075Help
Entry
M271_19075        CDS       T02907                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
src  Streptomyces rapamycinicus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:src01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:src01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:src00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:src00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4835531..4836742
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPATFGFECPPEILEDMLRN
LGDAHGYGDAKGLLSARRAVMQHYQTQGIDLDVEDIFLGNGVSELIQMSMQGLLDDGDEV
LVPAPDYPLWTAAVSLAGGTAVHYRCDEQSDWLPDLADIERKVTDRTKALVIINPNNPTG
AVYGEEILRGLTDIARRHQLIVCSDEIYDKILYDDATHTPTTAVAPDLLTLTFNGLSKAY
RVAGYRSGWLAVCGPKSHAASYLEGLTILANMRLCANMPAQHAVATALGGRQSINDLVLP
GGRLVEQRDTAYDLLTQIPGVTCVKPKGALYAFPKLDPKVYKIKDDRQMVLDLLRAEKIM
IVHGTGFNWPEPDHFRIVTLPAKEDLADAVTRIGNFLDGYGQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgatccagtccacgaagctcgccaacgtctgctacgaaatccgtggcccggtg
ctcgaggaggcgatgcggctggaggcggcaggacaccgcatcctcaagctcaacaccgga
aatccggcgaccttcggcttcgaatgccccccggagatcctcgaggacatgctccggaac
ctcggcgacgcccacggctacggcgacgccaagggactgctgtccgcgcggcgcgcggtg
atgcagcactaccagacccagggcatcgacctcgacgtcgaggacatcttcctcggcaac
ggcgtctcggagctgatccagatgtcgatgcaggggctgctggacgacggggacgaggtc
ctcgtccccgcccccgactatccgctgtggaccgccgcggtctcgctcgccgggggcacc
gccgtccactaccgctgcgacgagcagtcggactggctgccggacctcgccgacatcgag
cgcaaggtcaccgaccgcaccaaggcgctcgtcatcatcaacccgaacaaccccacgggc
gccgtctacggcgaggagatcctgcgcggcctcaccgacatcgcccgccgccaccagctg
atcgtctgctccgacgagatctacgacaagatcctctacgacgacgccacccacaccccg
accaccgccgtcgccccggacctgctgaccctcaccttcaacgggctctccaaggcgtac
cgggtggcgggctaccgcagcggctggctcgcggtctgcggcccgaagtcgcacgccgcc
agctatctggaggggctgaccatcctggccaatatgcggctgtgcgccaatatgccggcg
cagcacgcggtggccacggcgctcggcggccgccagtcgatcaacgacctggtgctcccc
ggcggccggctggtggagcagcgggacacggcgtacgacctgctgacccagatcccgggc
gtcacctgcgtgaagcccaagggcgcgctgtacgcgttcccgaagctggaccccaaggtc
tacaagatcaaggacgaccggcagatggtcctggacctgctgcgggccgagaagatcatg
atcgtgcacggcacggggttcaactggccggagccggatcacttccgcatcgtgacgctg
cccgccaaggaggatctggccgacgcggtgacccggatcggaaacttcctggacggatac
ggccaaccctga

DBGET integrated database retrieval system