KEGG   Streptomyces rapamycinicus: M271_19075Help
Entry
M271_19075        CDS       T02907                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
src  Streptomyces rapamycinicus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    M271_19075
   01230 Biosynthesis of amino acids
    M271_19075
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M271_19075
   00290 Valine, leucine and isoleucine biosynthesis
    M271_19075
Enzymes [BR:src01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     M271_19075
    2.6.1.66  valine---pyruvate transaminase
     M271_19075
Amino acid related enzymes [BR:src01007]
 Aminotransferase (transaminase)
  Class I
   M271_19075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4835531..4836742
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPATFGFECPPEILEDMLRN
LGDAHGYGDAKGLLSARRAVMQHYQTQGIDLDVEDIFLGNGVSELIQMSMQGLLDDGDEV
LVPAPDYPLWTAAVSLAGGTAVHYRCDEQSDWLPDLADIERKVTDRTKALVIINPNNPTG
AVYGEEILRGLTDIARRHQLIVCSDEIYDKILYDDATHTPTTAVAPDLLTLTFNGLSKAY
RVAGYRSGWLAVCGPKSHAASYLEGLTILANMRLCANMPAQHAVATALGGRQSINDLVLP
GGRLVEQRDTAYDLLTQIPGVTCVKPKGALYAFPKLDPKVYKIKDDRQMVLDLLRAEKIM
IVHGTGFNWPEPDHFRIVTLPAKEDLADAVTRIGNFLDGYGQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgatccagtccacgaagctcgccaacgtctgctacgaaatccgtggcccggtg
ctcgaggaggcgatgcggctggaggcggcaggacaccgcatcctcaagctcaacaccgga
aatccggcgaccttcggcttcgaatgccccccggagatcctcgaggacatgctccggaac
ctcggcgacgcccacggctacggcgacgccaagggactgctgtccgcgcggcgcgcggtg
atgcagcactaccagacccagggcatcgacctcgacgtcgaggacatcttcctcggcaac
ggcgtctcggagctgatccagatgtcgatgcaggggctgctggacgacggggacgaggtc
ctcgtccccgcccccgactatccgctgtggaccgccgcggtctcgctcgccgggggcacc
gccgtccactaccgctgcgacgagcagtcggactggctgccggacctcgccgacatcgag
cgcaaggtcaccgaccgcaccaaggcgctcgtcatcatcaacccgaacaaccccacgggc
gccgtctacggcgaggagatcctgcgcggcctcaccgacatcgcccgccgccaccagctg
atcgtctgctccgacgagatctacgacaagatcctctacgacgacgccacccacaccccg
accaccgccgtcgccccggacctgctgaccctcaccttcaacgggctctccaaggcgtac
cgggtggcgggctaccgcagcggctggctcgcggtctgcggcccgaagtcgcacgccgcc
agctatctggaggggctgaccatcctggccaatatgcggctgtgcgccaatatgccggcg
cagcacgcggtggccacggcgctcggcggccgccagtcgatcaacgacctggtgctcccc
ggcggccggctggtggagcagcgggacacggcgtacgacctgctgacccagatcccgggc
gtcacctgcgtgaagcccaagggcgcgctgtacgcgttcccgaagctggaccccaaggtc
tacaagatcaaggacgaccggcagatggtcctggacctgctgcgggccgagaagatcatg
atcgtgcacggcacggggttcaactggccggagccggatcacttccgcatcgtgacgctg
cccgccaaggaggatctggccgacgcggtgacccggatcggaaacttcctggacggatac
ggccaaccctga

DBGET integrated database retrieval system