KEGG   Streptomyces rapamycinicus: M271_19075Help
Entry
M271_19075        CDS       T02907                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
src  Streptomyces rapamycinicus
Pathway
src00220  Arginine biosynthesis
src00250  Alanine, aspartate and glutamate metabolism
src00290  Valine, leucine and isoleucine biosynthesis
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
src01130  Biosynthesis of antibiotics
src01210  2-Oxocarboxylic acid metabolism
src01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M271_19075
   00290 Valine, leucine and isoleucine biosynthesis
    M271_19075
   00220 Arginine biosynthesis
    M271_19075
Enzymes [BR:src01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     M271_19075
    2.6.1.66  valine---pyruvate transaminase
     M271_19075
Amino acid related enzymes [BR:src01007]
 Aminotransferase (transaminase)
  Class I
   M271_19075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGP55364
UniProt: A0A0A0NEF4
Position
4835531..4836742
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPATFGFECPPEILEDMLRN
LGDAHGYGDAKGLLSARRAVMQHYQTQGIDLDVEDIFLGNGVSELIQMSMQGLLDDGDEV
LVPAPDYPLWTAAVSLAGGTAVHYRCDEQSDWLPDLADIERKVTDRTKALVIINPNNPTG
AVYGEEILRGLTDIARRHQLIVCSDEIYDKILYDDATHTPTTAVAPDLLTLTFNGLSKAY
RVAGYRSGWLAVCGPKSHAASYLEGLTILANMRLCANMPAQHAVATALGGRQSINDLVLP
GGRLVEQRDTAYDLLTQIPGVTCVKPKGALYAFPKLDPKVYKIKDDRQMVLDLLRAEKIM
IVHGTGFNWPEPDHFRIVTLPAKEDLADAVTRIGNFLDGYGQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgatccagtccacgaagctcgccaacgtctgctacgaaatccgtggcccggtg
ctcgaggaggcgatgcggctggaggcggcaggacaccgcatcctcaagctcaacaccgga
aatccggcgaccttcggcttcgaatgccccccggagatcctcgaggacatgctccggaac
ctcggcgacgcccacggctacggcgacgccaagggactgctgtccgcgcggcgcgcggtg
atgcagcactaccagacccagggcatcgacctcgacgtcgaggacatcttcctcggcaac
ggcgtctcggagctgatccagatgtcgatgcaggggctgctggacgacggggacgaggtc
ctcgtccccgcccccgactatccgctgtggaccgccgcggtctcgctcgccgggggcacc
gccgtccactaccgctgcgacgagcagtcggactggctgccggacctcgccgacatcgag
cgcaaggtcaccgaccgcaccaaggcgctcgtcatcatcaacccgaacaaccccacgggc
gccgtctacggcgaggagatcctgcgcggcctcaccgacatcgcccgccgccaccagctg
atcgtctgctccgacgagatctacgacaagatcctctacgacgacgccacccacaccccg
accaccgccgtcgccccggacctgctgaccctcaccttcaacgggctctccaaggcgtac
cgggtggcgggctaccgcagcggctggctcgcggtctgcggcccgaagtcgcacgccgcc
agctatctggaggggctgaccatcctggccaatatgcggctgtgcgccaatatgccggcg
cagcacgcggtggccacggcgctcggcggccgccagtcgatcaacgacctggtgctcccc
ggcggccggctggtggagcagcgggacacggcgtacgacctgctgacccagatcccgggc
gtcacctgcgtgaagcccaagggcgcgctgtacgcgttcccgaagctggaccccaaggtc
tacaagatcaaggacgaccggcagatggtcctggacctgctgcgggccgagaagatcatg
atcgtgcacggcacggggttcaactggccggagccggatcacttccgcatcgtgacgctg
cccgccaaggaggatctggccgacgcggtgacccggatcggaaacttcctggacggatac
ggccaaccctga

DBGET integrated database retrieval system