KEGG   Streptomyces rapamycinicus: M271_19650Help
Entry
M271_19650        CDS       T02907                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
src  Streptomyces rapamycinicus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    M271_19650
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    M271_19650
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     M271_19650
Lipid biosynthesis proteins [BR:src01004]
 Desaturase
  First
   M271_19650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4958667..4959629
Genome map
AA seq 320 aa AA seqDB search
MVNDTPKAQEAPLSSATLGGDSKRSVEQITLLLFITVPFVALLAAIPLAWGWGVSWLDLA
LLVSMYYIGCHGITIGFHRYFTHGSFKAKRPLRIALAIAGSLAVEGPLVRWVADHRKHHK
FSDAEGDPHSPWRYGETVPALLKGLWWAHIAWMFDEEQTSQSKYAPDLIKDGAIRAVSRQ
FVVWTVVSLMVPPVIGGLVTWSWQGTVTAFFWGSLVRVALLHHVTWSINSICHAVGKRPF
KSRDRSGNVWWLAVLSCGESWHNLHHADPTCARHGVMRGQLDSSARIIRWFEKAGWAYDV
RWPSQDRIDARRQKETAGAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaatgacacgccgaaggcccaggaggccccgctttcctccgccacgctcggcggg
gacagcaagcgctccgtcgaacagatcacccttctcctgttcatcaccgtccccttcgtc
gcgctgctcgcggcaattcccctggcctggggctggggggtcagctggctggatctggcg
ctactggtgtcgatgtactacatcggctgccacggcatcacgatcggcttccaccgctac
ttcacccatggctcgttcaaggcgaagcggccgctgcggatcgcgctggcgatcgcgggg
tcgctggccgtggagggcccgctggtccgctgggtggccgatcaccgcaagcaccacaag
ttctccgacgcggagggcgacccgcactccccgtggcggtacggcgagaccgttccggcc
ctgctcaaggggttgtggtgggcacatatcgcctggatgttcgacgaggaacagacatcg
cagtccaaatacgcacccgatctgatcaaggacggcgccatccgggcggtctcccggcag
ttcgtggtgtggaccgtggtctccctgatggtgccgccggtgatcggcggactggtgacc
tggtcctggcagggcacggtgaccgccttcttctgggggtcactcgtccgggtggctttg
ctgcaccatgtgacgtggtcgatcaactcgatctgccacgcggtgggcaagcgccccttc
aagtcgcgggaccgctccggcaatgtgtggtggctcgcggtgctctcgtgcggcgagtcc
tggcacaacctgcaccacgcggacccgacctgcgcccggcacggggtgatgcgggggcag
ctggattccagcgcccggatcatccgctggttcgagaaggcgggctgggcgtatgacgtc
cggtggccgagccaggaccgtatcgatgcccgccgtcagaaggagaccgccggagcggca
tga

DBGET integrated database retrieval system