KEGG   Streptomyces rapamycinicus: M271_21800Help
Entry
M271_21800        CDS       T02907                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
src  Streptomyces rapamycinicus
Pathway
src00511  Other glycan degradation
src00600  Sphingolipid metabolism
src01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    M271_21800
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    M271_21800
Enzymes [BR:src01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     M271_21800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AGP55879
UniProt: A0A0A0NFX3
Position
5489022..5490485
Genome map
AA seq 487 aa AA seqDB search
MGALAAVAVAVGPWPTAPAGAQAARTGSASAGETVNVYLTTTSGSDGRNVVKGLERQTPI
TFTTGGGGNVTVDETRTYQEFSGAGASFTDTAAWLFNSSGALSQGTRDEVMRKLFSPTDG
IGVSFLRNPMGGSDLARFGYTFDDVPAGQTDPGLASFSISHDLADVLPLTQRAKQLNPAL
KVMASPWTAPAWMKDNDQLNQGWLEAQYYGTYANYFVRYLQEYKNRGVPIDYVTVQNEPT
CCGGYPSMQWNGSGLNYFTKSELLPKLANAGLNTKVLALDWNWDQWSGYGAPVVDDAAIR
NHPNFGGIAWHGYGGDVREQTTVHNQYPDVDAFDTEHSGGTWIANQQKEDMHNLIDYTRN
WGKSWIKWSLAVDQNKGPHNGGCSTCTGLVTVHNGDSQSGKVDYTVEYYTMGHLTKFVKP
GAHRIDSTAGSAVPNVAWKNPDGSKALIAYNDTGGQQTLKVNWGSQSFTHQLPAGASATF
TWTGNQS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgctctcgcggcggtcgcggtggccgtcggcccctggccgaccgctccggcaggc
gcccaggcggcccgcaccggctcggcatcggcgggcgagaccgtcaacgtctacctgacc
accacctccggctccgacggccgtaacgtcgtcaagggcctggagcggcagacgcccatc
acgttcacgactggcggcgggggcaacgtcacggtcgacgagacccggacgtaccaggag
ttctcgggcgcgggcgcatcgttcacggacaccgcggcatggctgttcaacagcagcggc
gcgctgagccagggcacccgcgacgaggtgatgcgcaagctcttctcccccaccgacggc
atcggtgtgagcttcctgcgaaacccgatgggcggctccgacctcgcccgtttcggctac
accttcgacgacgtaccggccggacagaccgaccccggcctcgccagcttctcgatcagc
cacgacctggccgatgtcctgccactgacccagcgggccaagcagctcaacccggctctg
aaggtcatggcctcgccgtggaccgcccccgcctggatgaaggacaacgaccagctcaac
cagggttggctggaggctcagtactacggcacctacgcgaactacttcgtgaggtacctc
caggagtacaagaaccgcggggtgccgatcgactacgtgaccgtgcagaacgagcccacc
tgctgcggcggctacccgtcgatgcagtggaacggttccggactcaactacttcaccaaa
agcgagctgctgcccaagctggcgaacgcgggcctgaacaccaaggtgctcgccctcgac
tggaactgggaccagtggtcgggttacggcgcgcccgtcgtggacgacgccgccatccgc
aaccaccccaacttcggcggtatcgcctggcacggctacggcggcgacgtccgcgagcag
acgaccgtccacaaccagtaccccgacgtggacgccttcgacaccgaacactccggcggc
acctggatcgccaaccagcagaaggaggacatgcacaacctgatcgactacacccgcaac
tggggcaagagctggatcaagtggagcctcgcggtcgatcagaacaagggcccccacaac
ggcggctgctccacctgcaccggcctggtcaccgtgcacaacggcgacagccagagcggc
aaggtcgactacaccgtcgagtactacacgatgggccacctcacgaagttcgtgaagccg
ggcgcccaccgcatcgactccaccgccggctcggccgtcccgaacgtggcctggaagaac
cctgacggctccaaagcgctgatcgcctacaacgacaccggcggccagcagacgctgaag
gtcaactggggcagccagtccttcacccaccagctccccgccggggcctccgccaccttc
acctggaccggcaaccagtcgtaa

DBGET integrated database retrieval system