KEGG   Streptomyces rapamycinicus: M271_27055Help
Entry
M271_27055        CDS       T02907                                 

Definition
glutamate decarboxylase
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
src  Streptomyces rapamycinicus
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:src00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:src00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:src00410]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:src00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(6619575..6620846)
Genome map
AA seq 423 aa AA seqDB search
MAPTTAYQFVHDELMLDGNARQNLATFVTTWMEPQAGRLMSDCFAKNMIDKDEYPRTAEL
ERRCVTMLGHLWHAPDPDAVVGCSTTGSSEACMLAGMAFKRRWAKRNPVSYPATARPNLV
MGTNVQVCWEKFCDFWEVEARQVPMEGDRYHLDPRAAAELCDENTIGVVAVLGSTFDGSY
EPVAEVCRALDDLQERTGLDIPVHVDGASGAMVAPFLDPDLVWDFQLPRVASINTSGHKY
GLVYPGVGWALWRTADALPEELVFRVDYLGGNMPTFSLNFSRPGSQVAAQYYTFVRLGRE
GYRAVQQQTRDVARSLAERIEAFGDFTMLSRGDQLPVFAFTTAEGIRGFDVYDVSRRLRE
RGWLVPAYTFPPNREDLSVLRVVCRNGFSEDLADLFLGDLGSLLPELRSQSAPMGKVVKA
FHH
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacgacggcgtatcagttcgtccatgacgagctgatgctggacggcaacgcc
cgccagaacctcgccacgttcgtcaccacgtggatggagccgcaggcgggccggctgatg
tccgactgcttcgccaagaacatgatcgacaaggatgagtatccgcgcaccgccgaactg
gagcggcggtgcgtgaccatgctcggccatctgtggcacgcccccgacccggacgcggtc
gtgggctgctccaccacggggtcgagcgaggcgtgcatgctggccggaatggccttcaag
cggcgctgggccaagcggaacccggtgagctatccggccaccgcccggcccaatctggtc
atgggcaccaatgtccaggtgtgctgggagaagttctgcgacttctgggaggtggaggcc
cggcaggtgcccatggagggcgaccggtaccacctcgatccccgggccgccgccgagctg
tgcgacgagaacaccatcggggtcgtcgcggtcctcggctccaccttcgacggctcctac
gaacccgtcgccgaggtgtgccgggcgctggacgacctccaggagcgcacgggcctggac
atcccggtgcacgtggacggcgcctcgggcgcgatggtcgcgccgttcctcgacccggac
ctggtgtgggacttccagctgccgcgggtcgcctccatcaacacctcgggccacaagtac
ggcctggtctaccccggggtgggatgggcgctgtggcgtacggcggacgcgctgcccgag
gagctggtcttccgcgtcgactacctcggcggcaatatgcccacgttctcgctcaacttc
tcccgccccggctcccaggtggccgcccagtactacaccttcgtacggctgggccgggag
ggctaccgcgccgtccagcagcagacccgcgatgtggcgcgctcgctcgccgagcggatc
gaggcgttcggggacttcaccatgctcagccgcggcgatcagctgccggtgttcgcgttc
accacggcggaggggatccgcggcttcgacgtctacgacgtctcccggcggctgcgcgaa
cgcggctggctggtgcccgcgtacaccttcccgcccaaccgggaggacctgtccgtactg
cgggtggtgtgccgcaacggcttctcggaggacctcgccgatctcttcctgggcgacctg
gggtcgctgctgccggagctgcggtcacagtccgcgcccatggggaaggtcgtcaaggcg
ttccatcactga

DBGET integrated database retrieval system