KEGG   Streptomyces rapamycinicus: M271_27055Help
Entry
M271_27055        CDS       T02907                                 

Definition
glutamate decarboxylase
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
src  Streptomyces rapamycinicus
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    M271_27055
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M271_27055
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M271_27055
   00430 Taurine and hypotaurine metabolism
    M271_27055
Enzymes [BR:src01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     M271_27055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(6619575..6620846)
Genome map
AA seq 423 aa AA seqDB search
MAPTTAYQFVHDELMLDGNARQNLATFVTTWMEPQAGRLMSDCFAKNMIDKDEYPRTAEL
ERRCVTMLGHLWHAPDPDAVVGCSTTGSSEACMLAGMAFKRRWAKRNPVSYPATARPNLV
MGTNVQVCWEKFCDFWEVEARQVPMEGDRYHLDPRAAAELCDENTIGVVAVLGSTFDGSY
EPVAEVCRALDDLQERTGLDIPVHVDGASGAMVAPFLDPDLVWDFQLPRVASINTSGHKY
GLVYPGVGWALWRTADALPEELVFRVDYLGGNMPTFSLNFSRPGSQVAAQYYTFVRLGRE
GYRAVQQQTRDVARSLAERIEAFGDFTMLSRGDQLPVFAFTTAEGIRGFDVYDVSRRLRE
RGWLVPAYTFPPNREDLSVLRVVCRNGFSEDLADLFLGDLGSLLPELRSQSAPMGKVVKA
FHH
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacgacggcgtatcagttcgtccatgacgagctgatgctggacggcaacgcc
cgccagaacctcgccacgttcgtcaccacgtggatggagccgcaggcgggccggctgatg
tccgactgcttcgccaagaacatgatcgacaaggatgagtatccgcgcaccgccgaactg
gagcggcggtgcgtgaccatgctcggccatctgtggcacgcccccgacccggacgcggtc
gtgggctgctccaccacggggtcgagcgaggcgtgcatgctggccggaatggccttcaag
cggcgctgggccaagcggaacccggtgagctatccggccaccgcccggcccaatctggtc
atgggcaccaatgtccaggtgtgctgggagaagttctgcgacttctgggaggtggaggcc
cggcaggtgcccatggagggcgaccggtaccacctcgatccccgggccgccgccgagctg
tgcgacgagaacaccatcggggtcgtcgcggtcctcggctccaccttcgacggctcctac
gaacccgtcgccgaggtgtgccgggcgctggacgacctccaggagcgcacgggcctggac
atcccggtgcacgtggacggcgcctcgggcgcgatggtcgcgccgttcctcgacccggac
ctggtgtgggacttccagctgccgcgggtcgcctccatcaacacctcgggccacaagtac
ggcctggtctaccccggggtgggatgggcgctgtggcgtacggcggacgcgctgcccgag
gagctggtcttccgcgtcgactacctcggcggcaatatgcccacgttctcgctcaacttc
tcccgccccggctcccaggtggccgcccagtactacaccttcgtacggctgggccgggag
ggctaccgcgccgtccagcagcagacccgcgatgtggcgcgctcgctcgccgagcggatc
gaggcgttcggggacttcaccatgctcagccgcggcgatcagctgccggtgttcgcgttc
accacggcggaggggatccgcggcttcgacgtctacgacgtctcccggcggctgcgcgaa
cgcggctggctggtgcccgcgtacaccttcccgcccaaccgggaggacctgtccgtactg
cgggtggtgtgccgcaacggcttctcggaggacctcgccgatctcttcctgggcgacctg
gggtcgctgctgccggagctgcggtcacagtccgcgcccatggggaaggtcgtcaaggcg
ttccatcactga

DBGET integrated database retrieval system