KEGG   Streptomyces rapamycinicus: M271_28865Help
Entry
M271_28865        CDS       T02907                                 

Definition
pyrimidine-nucleoside phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
src  Streptomyces rapamycinicus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M271_28865
Enzymes [BR:src01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     M271_28865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7077841..7079124
Genome map
AA seq 427 aa AA seqDB search
MDAISVIRAKRDGTRLTDAQIDWIIDAYTRGEVADEQMSALAMAIFLNGMDRAEIARWTA
AMIASGERMDFSSLPRPTSDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRAQLTNGDMLAVLRDVGSVICAAGEGLARADKKLYALRDVTGTVESIPLI
ASSIMSKKIAEGTGSLVLDVKVGSGAFMKDIESARELAATMVGLGNDHGVRTTALLTDMS
TPLGRTAGNALEVRESVEVLAGGGPADVVELTLALAREMLDAAGLKDADPTKALADGTAM
DHWRRMITAQGGDPDAPLPVAREHHVLHAESTGVLTRLDAYAVGLAAWRLGAGRARKEDP
VQAGAGIELHAKPGDHITAGQPLLTLHTDTPSAFPYALEALSDAIGYAPANTEFTAAPIV
LDRIAQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatctccgtcatccgcgccaagcgcgacggcacccgcctcaccgacgcccag
atcgactggatcatcgacgcctacacgcgcggcgaggtggcggacgagcagatgtccgcg
ctcgcgatggcgatcttcctcaacggcatggaccgggccgagatcgcccgctggaccgcc
gcgatgatcgcgtccggtgagcggatggacttctcctccctgccgcgcccgacctccgac
aagcactccaccggcggcgtcggcgacaagatcaccctgccgctcgcccccctggtggcc
gcctgcggagccgccgtaccgcagctctccggccggggcctgggtcacaccggcggcacc
ctggacaagctggagtccatccccggctggcgcgcccagctgaccaatggcgacatgctg
gccgtcctccgcgacgtcggctcggtgatctgcgcggcgggcgaggggctggcccgggcc
gacaagaagctgtacgccctgcgcgatgtcaccggcacggtcgagtcgatcccgctcatc
gcctcttcgatcatgtccaagaagatcgccgagggcaccggctccctggtcctggacgtc
aaggtgggctccggcgccttcatgaaggacatcgagtccgcgcgcgaactggcggccacg
atggtcggcctcggcaacgaccacggcgtacgtacgaccgccctgctcaccgacatgtcc
accccgctcggccggacggcgggcaacgccctcgaggtccgcgagtccgtggaggtcctg
gcgggcggcggcccggccgacgtcgtcgagctcaccctcgccctggcccgcgagatgctg
gacgcggcgggcctgaaggacgccgaccccaccaaggccctggccgacggcaccgcgatg
gaccactggcgccgcatgatcaccgcccagggcggcgacccggacgccccgctcccggtg
gcccgcgaacaccacgtcctccacgccgagtcgaccggcgtcctcacccgcctggacgcc
tacgcggtgggcctcgccgcctggcgcctgggcgcgggccgcgcccgaaaggaggacccg
gtacaggcgggcgcgggcatagaactccacgccaaaccaggcgaccacatcaccgccggc
cagcccctcctcaccctccacaccgacaccccgtcggccttcccctacgccctggaggcc
ctgtcggacgcgatcggctacgcccccgcgaacacggaattcaccgcggccccgatcgtc
ctggaccgcatcgcccaggggtag

DBGET integrated database retrieval system