KEGG   Streptomyces rapamycinicus: M271_35050Help
Entry
M271_35050        CDS       T02907                                 

Definition
neuramidase
Orthology
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
src  Streptomyces rapamycinicus
Pathway
Other glycan degradation
Sphingolipid metabolism
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:src00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:src00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8604038..8605165
Genome map
AA seq 375 aa AA seqDB search
MAVDTGAARSYEVSVPFRAGTEGYASYRIPAVALTHDGTVLAFAEGRVDSSADDGHIDLV
LKRSADGGRTWDALQVVARNGDGTAGNPAPVVLDGGPNGGRVLLVHVRSAASATEDRIRR
GEVSAADGRRVWLTYSDDDGASWSEAREITASTKRPEWRWYATTPGHALQLRYGPHAGRI
VIPGNHSLPPTVPGDDGTEGRYNGGHDLLSDDDGATWRIGYVDDNPDGYINVNETTAAQL
PDGRVYFNTRTDATAPGTRADAHSGDGGATLDLPFRPQAGLVAPVVECGVLHLGEPDALL
FSGPADPAYRALMTVRTSLDGGITWRPSHTVNGLPAAYSDLVRLDDATVGLLYETGDFSA
YSTITFRRIPMEELV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgacacgggggcggcacgctcgtacgaggtgtccgttccgttccgggcgggg
accgagggctatgcgagctaccggatcccggccgtcgcgctgacccacgacggcaccgtc
ctcgcgttcgccgagggccgggtggactcctccgccgacgacggccatatcgacctcgtg
ctcaagcggtcggccgacggcggacggacctgggacgccttacaggtggtggcccgcaac
ggcgacggaacggcgggcaaccccgcccccgtcgtcctcgacggcggcccgaacggcggc
cgcgtcctgctggtgcacgtccgcagcgcggcctccgccaccgaggaccggatccggcgc
ggcgaggtgagtgcggccgacgggcggcgggtgtggctgacgtacagcgatgacgacggc
gcgagctggagcgaggcgcgcgagatcaccgcgagtaccaagcggcccgaatggcgctgg
tacgccaccacccccggccatgccctgcagttgcggtacggcccccacgcgggccggatc
gtcatccccggcaatcactccctgccgccgaccgtccccggcgacgacggcaccgagggc
cgctacaacggcgggcacgacctgctcagcgacgacgacggcgccacctggcggatcggg
tacgtggacgacaaccccgacggctatatcaacgtcaacgagaccaccgccgcccaactc
ccggacggccgcgtctacttcaacacccgcaccgacgccaccgcgcccggcacccgcgcc
gacgcccactccggtgacggcggcgccaccctggacctccccttccggccgcaggccgga
ctggtcgccccggtggtggagtgcggcgtgctgcacctcggcgagccggacgcgctgctc
ttctccggccccgccgaccccgcgtaccgggcgctgatgaccgtccgcaccagccttgac
ggcggcatcacctggcggccgagccacaccgtgaacggcctgcccgccgcctactccgat
ctggtccggctcgacgacgccacggtcggactgctctacgagaccggcgacttcagcgcc
tactcgaccatcacattccggcgcattccgatggaggagctggtttga

DBGET integrated database retrieval system