KEGG   Streptomyces rapamycinicus: M271_35725Help
Entry
M271_35725        CDS       T02907                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
src  Streptomyces rapamycinicus
Brite
Enzymes [BR:src01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     M271_35725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(8768243..8769064)
Genome map
AA seq 273 aa AA seqDB search
MVPLLPGAEPFRHDGGEIGVLVCHGFTGSPQSVRPWADHLAARGLTVSLPLLPGHGTRWQ
DLAVTGWQDWYAEVDRELARLSRECERVFVCGLSMGGALALRLAAQHGAAISGVAVVNPA
NRIHDPLAVALPVLRHLVPSVKGIVSDIAKPGSRESGYERMPLHAVHSMRRFYRVVDAEL
PQVTQPLLVMHSPQDHVVPPADSERILSQVSSRDVTERLLERSYHVATLDHDAEFIFEET
DTFITRLTAGMGEDTTRTGLGKGSGREGAAASG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtggtgccgctcctgcccggagccgagccgttccgccacgacggcggagagatcggcgtc
ctcgtctgtcacggattcaccggctccccgcagtccgtgcggccctgggccgaccatctc
gcggcccgtggtctgaccgtctcactgccgctgcttcccggccatggcacgcgctggcag
gatctcgccgtcaccggctggcaggactggtacgcggaggtggaccgcgagctggccagg
ctctcccgggagtgcgagcgggtgttcgtctgcggtctgtcgatgggcggggcgctcgcg
ctgcggctggccgcccagcacggcgcggcgatcagcggcgtggccgtcgtgaacccggcc
aaccgcatccacgatccgctggccgtggcccttccggtgctgcgtcatctggtgccgtcg
gtgaagggcatcgtgagcgacatcgccaagccagggtcgcgggagtcgggttacgagcgg
atgccgctgcacgccgtgcactcgatgcgccgcttctaccgggtggtcgacgccgaactg
ccacaggtgacccagccgctgctggtgatgcacagcccccaggaccatgtggtgccgccg
gccgactccgagcgcatcctcagtcaggtgtcctcgcgggatgtcaccgagcggctgctc
gagcgcagctaccacgtggcgacgctggaccacgacgccgagttcatcttcgaggagacg
gacacgttcatcacccggctgacggcgggtatgggtgaagacaccacccggaccggcctc
gggaagggcagcggaagggagggggcggcggccagtggctga

DBGET integrated database retrieval system