KEGG   Streptomyces rapamycinicus: M271_42250Help
Entry
M271_42250        CDS       T02907                                 

Definition
hypothetical protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
src  Streptomyces rapamycinicus
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:src00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:src00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:src00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:src00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:src00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:src00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(10468490..10470523)
Genome map
AA seq 677 aa AA seqDB search
MTDAPRDNSATRARWQTCLKLARELLLIGPDDTDLKLGYLHTLIDTGSLGVTRHPRKKIL
IIGAGITGLVAGRLLKDAGHDVTILEANTGRAGGRIKTFRTTKHHQPFDDAAQYAEAGAM
RLPDFHPLVLALVDKLGLGRRLFYNVDVDPATGSGPDVPVPPVTYTSFTGRTWTYGDDSP
DFREPDKRGNTWIRTNRVQVRRADYSAVPEKINEGFHLTDDEVRAPAVRMVDDALESVRD
YYSDVVDGKRVNKPLEEWIEGWARVIHDFDGYSMGGFLRDYAGFSDEAIEAVGTLENMSS
RLHLSFFHSFLSHTDISPGVRYWEIPGGSWRLPDALHRGLRDEVRFGHRMIRLEYFDPSR
DSAPEGTGAVGPDGWGVAVQTVAEDNPAGPTRLWTADLAIVAIPFSTLRFVEIVPSMSYK
KRRAIIETHYDSATKVLLEFSHRWWEFTEDDWREELDGITPGLYDYYQRGGTGTDPVPAL
AEAGRDLLGAAVKDSGVTEELRQVNSTMPLRGPAVRPATHCFGGGSATDNPNRFMYYPSH
PVEGSTGGVVLASYSWSDDAARWDSMREVERYVYALRNLQALHGRRIEVFFTGLGATKSW
ARDPYAFGEAATYTPHQMTSFHLDASRPEGPVHFAGEHTSLKHAWIEGALESAVRAATAV
HQAPPLTTPGPDQKGSS
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgctccacgcgataactccgccacccgtgcgcgctggcagacctgtctcaag
ctggcccgcgaactcctcctcatcggaccggacgacaccgacctcaaactcggctatctc
cacaccctcatcgacacgggcagcctcggcgtcacccgccacccccgcaagaagatcctc
atcatcggcgccggtatcaccggcctggtggccggccgcctgctcaaggacgcgggccac
gacgtcaccatcctggaggccaacaccggccgtgccggcgggcgcatcaagaccttccgc
accaccaagcaccaccagccgttcgacgacgccgcccagtacgccgaggccggcgccatg
cggctgcccgacttccatccgctcgtcctcgccctcgtcgacaaactcgggctcggccgc
cgcctgttctacaacgtggacgtcgaccccgccaccggcagcggccccgatgtccccgtc
cccccggtgacgtacacctccttcaccggccgcacctggacctacggcgacgacagcccc
gacttccgcgagcccgacaagcgcggcaacacctggatccgcaccaaccgcgtccaggtg
cggcgcgccgactacagcgccgtcccggagaagatcaacgagggtttccacctcaccgac
gacgaggtccgcgcccccgccgtgcggatggtcgacgacgcgctggagagcgtgcgggac
tactactccgacgtcgtggacggcaagcgggtcaacaagccgctcgaggagtggatcgag
ggctgggcccgggtgatccatgacttcgacggctattcgatgggcggcttcctgcgcgac
tacgcagggttcagcgacgaggccatcgaggcggtcggaacgctggagaacatgtcgtcg
cggctccatctctccttcttccacagcttcctgagccacaccgacatcagccccggtgtg
cgctactgggagatacccggcggcagctggcgactgccggacgccctccaccggggcctg
cgcgacgaggtgcggttcggtcaccgcatgatccgcctggagtacttcgaccccagccgc
gactccgcccccgagggcaccggcgctgtcggacccgacggctggggcgtggccgtgcag
accgtcgccgaggacaacccggcgggccccacccgcctgtggaccgcggacctggcgatc
gtcgccatcccgttctccaccctgcgcttcgtggagatcgtcccctcgatgtcgtacaag
aagcgccgcgccatcatcgagacccactacgactcggccaccaaggtgctgctggagttc
agccaccggtggtgggagttcaccgaggacgactggcgcgaggagctcgacggcatcaca
ccgggcctctacgactactaccagcgcggcgggaccggcaccgatcccgtgcccgcgctc
gccgaggcgggccgcgacctgctcggcgccgcggtcaaggacagcggtgtcaccgaggag
ttgcgccaggtcaacagcaccatgccactgcgcggccccgccgtgcgccccgccacccac
tgcttcggtggcggctccgccaccgacaaccccaaccggttcatgtactacccctcgcac
ccggtcgagggcagcaccggcggtgtggtgctcgcctcgtactcctggtccgacgacgcc
gcgcgctgggactccatgcgcgaggtggagcgctatgtctacgccctgcgcaacctccag
gccctgcacggacgccgcatcgaggtgttcttcaccggcctgggcgccaccaagagctgg
gcccgcgacccgtacgccttcggcgaggccgccacgtacaccccgcaccagatgaccagc
ttccacctggacgcctcccgccccgagggcccggtgcacttcgccggggagcacacctcg
ctcaagcacgcctggatcgagggcgccctggagagcgccgtccgcgccgccaccgccgtc
caccaggcaccgcccctcaccaccccgggtccggaccagaagggcagttcatga

DBGET integrated database retrieval system