KEGG   Streptomyces rapamycinicus: M271_50520Help
Entry
M271_50520        CDS       T02907                                 

Definition
hypothetical protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
src  Streptomyces rapamycinicus
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:src00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M271_50520
   00330 Arginine and proline metabolism
    M271_50520
   00340 Histidine metabolism
    M271_50520
   00350 Tyrosine metabolism
    M271_50520
   00360 Phenylalanine metabolism
    M271_50520
   00380 Tryptophan metabolism
    M271_50520
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     M271_50520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12615870..12617408
Genome map
AA seq 512 aa AA seqDB search
MLYSAMGALGLAPVPDVRAEEYRAPQRNDFALTGRGGKKVLVLGGGIAGLATAYELGKAG
YDCQILEAKDRPGGRNWTVRGGTALTDLDGRTQTASFTKGQYMNAGPARLPQSHVTLEYC
RELGVELQVFTNQNANAYIYHESSAALAGKPMRWRTAKADVYGYLSELLAKATDQGALDA
RLTPQDKERLIAFLQSFGAIKGKAGGYAYTGTDRRGYSAEPGAAFDDGTVLSPVPTLSDV
IASGVGQRFAFELGYDQAMLMFQPVGGMDAIPYALAKAIGQNRITYGAKALEVKDLPDGA
EVTYKDVGGRTRTQRADFVVAAMPPMVMARLKHNLGTDITAALKYAVPTPVGKIGLEYRS
RWWETDEHIYGGITPTDTDLATIWYPSYGHQGRRGTLIGYYNFGANAVAYSDLPHAHRLA
RAVSRGVKIHGDKYRTELDHSFSVAWHRTPHIEAGWVDWPSQTGPEYKLLNQPAGHVYFA
GDWLSHVIAWQHGAFSSARKVVTDIHERVMAA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtactcggcgatgggcgcactcgggctcgccccggtgccagacgtgcgggcggaa
gagtatcgggcgccccagcgaaacgacttcgcgctcaccggacgcggcggcaagaaggta
ctcgtgctcggcggcggcatagccggcctggcgacggcgtacgagctgggcaaagccggt
tacgactgccagatcctggaggcgaaggaccgccccgggggccgcaactggacggtccgc
ggcggcacggcgctgaccgacctcgacgggcggacgcagacggcgtcgttcaccaagggc
cagtacatgaacgcgggcccggcccggctgccgcagtcccacgtcactctcgagtactgc
cgcgaactcggcgtcgaactacaggtgttcaccaaccagaacgccaacgcgtacatctac
cacgagagcagcgccgccctcgcgggcaagcccatgcgctggcgcacggcgaaggccgac
gtctacggctacctctccgagttgctcgccaaggccaccgaccagggcgccctggacgca
cggctcaccccgcaggacaaggaacgactgatcgcgttcctgcagagcttcggcgccatc
aagggcaaagccggcggctacgcctacaccggcaccgaccggcgaggctactccgccgag
ccgggcgcggccttcgacgacggcacggtcctcagcccggtgccgacgctgtcggacgtc
atcgccagcggcgtggggcagcgcttcgccttcgaactcggctacgaccaggccatgctg
atgttccagccggtgggcggcatggacgctatcccgtacgccctggccaaggcgatcggc
cagaaccgcatcacctatggcgccaaggcgctggaggtcaaggacctgccggacggtgcc
gaggtcacgtataaggacgtcggcggccgtacccgcacccagcgcgccgacttcgttgtc
gcggccatgccgccgatggtcatggcccgcctcaagcacaacctgggcaccgacatcacc
gcggcgctgaagtacgccgtcccgacccccgtcggcaagatcgggctcgagtaccgcagc
cgatggtgggagacggacgagcacatctacggtggcatcacgccgaccgacaccgacctg
gccaccatctggtacccctcttacggccaccagggccgccgcggcacactcatcggctac
tacaacttcggtgccaacgccgtcgcgtacagcgatctgccgcacgcccaccgccttgcg
cgggcggtgagccggggcgtgaagatccacggcgacaagtaccgcaccgaactcgatcac
tccttcagcgtggcctggcaccgcacgcctcatatcgaggccggctgggtggactggccc
tcgcagaccggtcccgagtacaagctgctcaaccagcccgccgggcacgtctacttcgcc
ggcgactggctcagccatgtcatcgcctggcagcacggcgcgttcagctcggcccgcaag
gtcgtgaccgacatccacgaaagggtgatggccgcatga

DBGET integrated database retrieval system