KEGG   Stenotrophomonas rhizophila: BAY15_2716Help
Entry
BAY15_2716        CDS       T04500                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
srh  Stenotrophomonas rhizophila
Pathway
srh00071  Fatty acid degradation
srh00072  Synthesis and degradation of ketone bodies
srh00280  Valine, leucine and isoleucine degradation
srh00310  Lysine degradation
srh00362  Benzoate degradation
srh00380  Tryptophan metabolism
srh00620  Pyruvate metabolism
srh00630  Glyoxylate and dicarboxylate metabolism
srh00640  Propanoate metabolism
srh00650  Butanoate metabolism
srh00900  Terpenoid backbone biosynthesis
srh01100  Metabolic pathways
srh01110  Biosynthesis of secondary metabolites
srh01120  Microbial metabolism in diverse environments
srh01130  Biosynthesis of antibiotics
srh01200  Carbon metabolism
srh01212  Fatty acid metabolism
srh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:srh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAY15_2716
   00630 Glyoxylate and dicarboxylate metabolism
    BAY15_2716
   00640 Propanoate metabolism
    BAY15_2716
   00650 Butanoate metabolism
    BAY15_2716
  Lipid metabolism
   00071 Fatty acid degradation
    BAY15_2716
   00072 Synthesis and degradation of ketone bodies
    BAY15_2716
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAY15_2716
   00310 Lysine degradation
    BAY15_2716
   00380 Tryptophan metabolism
    BAY15_2716
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAY15_2716
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAY15_2716
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAY15_2716
Enzymes [BR:srh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAY15_2716
Exosome [BR:srh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAY15_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOA73150
UniProt: A0A1B2N6K0
Position
3095083..3096258
Genome map
AA seq 391 aa AA seqDB search
MPNIVIAAAKRTAIGSFLGQFNGVPTPTLGATAIAAALEQSGVPAADVSEVIMGCVLPAN
LGQAPARQAAVAAGIPYATGATTLNKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRFGNFQAVDHMAHDGLVNAYDGKAMGEFAECAVDKFQFSREEQDAYAI
ESVRRAQAAQAAGAFDDEIVAVKVAGRKGDVEYSQDEQPGRSDIAKIPTLRPAFKKDGTV
TAASSSSISDGAAAVVLLSEDDAAARGVQPLARIVAHATHSQEPEWFTTAPIGAIHKVLE
KAGWRLDQVDLFEINEAFAVVAMAPIRELGIDPAKVNVNGGACALGHPIGASGARLVVTL
VNALRKRDAKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacattgtcatcgccgctgccaagcggaccgccatcggttccttcctcggccag
ttcaacggcgtgcccacccccaccctgggcgccactgccatcgccgccgccctggaacag
tccggcgtgccggcggcggatgtctccgaagtgatcatgggctgcgtgctgccggccaac
ctgggccaggccccggcccgccaggccgccgtggccgcagggatcccctacgccaccggc
gcaaccaccctgaacaaggtttgcgggtcgggcatgaaggccatcatgctgggccacgac
ctgatcaaggccggctcggccagcatcgtggtcgccggcggcatggaatcgatgtccaac
gcgccgcacctgctgcccaattcgcgcaccggcaaccgcttcggcaacttccaggcggtc
gaccacatggcccacgacggcctggtcaatgcgtacgacggcaaggccatgggcgaattc
gccgaatgcgcggtggacaagttccagttcagccgcgaggaacaggacgcgtatgcgatc
gaatcggtgcgccgcgcgcaggccgcgcaggctgccggcgcgttcgatgatgaaatcgtg
gccgtgaaggttgcgggtcgcaagggcgacgtggagtacagccaggacgagcagcccggc
cgttcggatatcgccaagatcccgaccctgcgcccggcgttcaagaaggacggcacggtg
actgccgccagctcgtcgagcatttccgacggcgctgccgccgtcgtgctgctgtccgaa
gacgatgcggccgcccgcggcgtgcagccgcttgcccggatcgtggcccacgccacccac
tcgcaggaaccggagtggttcaccaccgcgccgatcggcgccatccacaaggtgcttgaa
aaagccggctggcgcctggaccaggtggacctgttcgagatcaacgaggcgttcgccgtg
gtggccatggcgcccatccgcgaactgggcatcgacccggcgaaggtcaacgtcaacggc
ggcgcctgcgcactgggccacccgattggtgcctcgggcgcccggctggtggtgacgttg
gtcaatgccttgcgcaagcgtgatgcaaagcgcggaattgctacactgtgcattggtggc
ggggaagcaaccgccatcgccatcgaattgatttga

DBGET integrated database retrieval system