KEGG   Selenomonas ruminantium: SELR_00170Help
Entry
SELR_00170        CDS       T01799                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sri  Selenomonas ruminantium
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SELR_00170
Enzymes [BR:sri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SELR_00170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(20834..21430)
Genome map
AA seq 198 aa AA seqDB search
MENKIYALMGAQASGKATMAAELKKMGIHFIPVYTTQDFSEHKTNRCQVHREDFYKTVSR
EEFSQLDLVVEFTHKGESYGYRKDDILNSLRDHTISMMILEITGLKPMNKLIKKKLATIF
LMVDYVTLVDRLLRQGYNNDEIKYHLQYAENNKEFDLWKICTHIIRNTCDKETALIQILS
IMGLTMPLPQAQFIEMTK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaagatctacgcactgatgggtgcgcaagcttccggcaaagccaccatggcc
gccgaactgaaaaaaatggggatacactttattccggtctacactacacaggatttcagc
gaacataaaaccaaccgatgccaggtacaccgggaagatttctataaaaccgtcagccgg
gaggaattttcccagctggatctggttgtggaattcacccataaaggtgaatcctacggc
tatcggaaagatgatattctaaattccctgcgggatcataccatcagcatgatgatcctc
gaaatcactgggctcaagcctatgaacaagctgatcaagaaaaaactggccacaatcttc
ctgatggtggattatgtcactttggtagaccgcctgttgcggcaggggtataacaacgac
gaaataaaatatcacctgcagtatgcagagaacaacaaggaattcgatctttggaagata
tgtacccatatcatccgcaacacctgcgacaaggaaacggcactgatccagatcctgtcg
atcatgggattgaccatgccgctgccgcaggcacaattcatcgaaatgacaaaataa

DBGET integrated database retrieval system