KEGG   Selenomonas ruminantium: SELR_01490Help
Entry
SELR_01490        CDS       T01799                                 

Gene name
sucC
Definition
putative succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sri  Selenomonas ruminantium
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SELR_01490 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SELR_01490 (sucC)
   00640 Propanoate metabolism
    SELR_01490 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SELR_01490 (sucC)
Enzymes [BR:sri01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SELR_01490 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
177161..178348
Genome map
AA seq 395 aa AA seqDB search
MNIHEYQSKAVLKSYGVTVPEGYPAFSVEEAVENAQKLGTPVVVVKAQIHAGGRGKAGGV
KLAKNLDEVKAYATELLGKTLVTHQTGPEGKKVGRLLIEAGSNIKKEYYLSFVIDRQTAR
VVMMGSEEGGMEIEKVAAEMPDKIFKEYIDPAVGLAPFQATRMAYNINIPQEAIRKATKL
MGCLYNAFVGKDCSLAEINPLVVTADDDVVALDAKLNFDDSALFRHPDIEALRDESEEDP
KERRAAEAGLNYVNLGGDVACMVNGAGLAMATVDIIKHYGGEPANFLDVGGDSSPEKIAE
AFQIMLDGGQAKGIFVNIFGGINRCDAVAAGIVEAAKIISDDGKSLPVPVVVRLEGTNVE
QGRKILQDSPIANVIMAPTMEGGAEEIVKRVKAAE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcaaagcaaggcagtattgaaatcctatggtgtcactgtaccg
gaaggatatcctgccttcagcgtagaagaagccgtggaaaatgcccaaaagctcggtacg
ccggtggtagtggtaaaggcccagatccatgcaggcgggcgcggcaaggctggcggtgtc
aagctggcgaagaacctggacgaggtgaaagcttacgcgacggaacttttagggaagacc
ttggttacccatcagacaggtcctgaaggcaagaaagttggccgcctcctgattgaagct
ggttccaatatcaagaaggaatattatctctccttcgtcattgaccgtcagacggcccgt
gtggtcatgatgggctctgaagaaggtggtatggagatcgagaaggttgcagctgagatg
ccggacaagatcttcaaggaatatatcgatccggctgtcggtctggctcccttccaggct
acccgcatggcgtacaatatcaatatcccacaggaagccatccgcaaggctaccaagttg
atgggctgcctctacaatgcctttgtgggcaaggattgttcgctggcagagatcaatccg
ctggtggtgacggctgatgacgatgtggtggccctcgatgcgaagctgaatttcgatgac
agtgccctgttccgtcatccggatatcgaagccctccgtgatgagagcgaggaagatccg
aaggaacgccgtgcagcggaagccgggctcaactatgtcaacctcggcggcgatgtggcc
tgcatggtcaatggtgctggcctggctatggctacggtggatatcatcaagcattatggt
ggcgaaccggctaacttcctcgatgtaggcggcgattcctcgccggagaagattgcggaa
gctttccagatcatgctggacggcggtcaggccaaaggtatcttcgtcaacatcttcggc
ggtatcaaccgctgcgatgctgtagctgccggtatcgtggaagctgcgaagatcatttcc
gatgatggcaaatccctgccggtgcctgttgtggtacgcttagagggtaccaatgtggaa
cagggccgcaagattttgcaggattcccccattgccaatgttatcatggcaccgactatg
gagggcggcgcagaggaaatcgtcaaacgagtcaaagcagcagaataa

DBGET integrated database retrieval system