KEGG   Selenomonas ruminantium: SELR_02250Help
Entry
SELR_02250        CDS       T01799                                 

Gene name
glpK
Definition
putative glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sri  Selenomonas ruminantium
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SELR_02250 (glpK)
Enzymes [BR:sri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SELR_02250 (glpK)
Exosome [BR:sri04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SELR_02250 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
262095..263597
Genome map
AA seq 500 aa AA seqDB search
MAKNYVMALDAGTTSNRAIIFDKNSKIVGVSQKEFTQYFPEPGWVEHDADEIWSSMTTVM
KEALEQSGLVASDIAAIGITNQRETTVVWDKNTGRPVYNAIVWQSRQTAPIAEDLKKKGL
VDEVKDKTGLLIDAYFSATKIKWILDKVEGAREKAEKGDLLFGTIDTWLIWKLTGGKAHV
TDYSNASRTMLYNINELKWDDALLGYLDVPKCMLPEVKPSSCVYGETIPSILGAPIPVSG
AAGDQQAALFGQNCFEPGMAKNTYGTGCFMLMNTGTEIHKSKNGLVTTIAWGLDGKVEYA
LEGSIFVAGSAIQWLRDGVRMVDSAPDSEWVSKKVKDNGGVYVVPAFVGLGAPYWDMNAR
GTIIGITRGTTKAHIVRATLESLAYQTRDVLEAMEADSGEKLSALKVDGGAVANNLLMQF
QSDLLGVPVDRPQITETTALGAAYLAGLAVGVWDNKEELKSSWKLDSRFESQMEKTEADR
LYKGWRKAVKHSMHWLDEED
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaattatgtaatggctttggatgcaggtacgacgagcaatcgcgcgattatt
ttcgacaagaactcgaagatcgtcggcgtttcccagaaggaattcacccagtatttcccg
gaaccgggctgggttgagcacgatgcagacgaaatctggagctccatgaccacggtcatg
aaggaagctctggagcagtccggtctcgtagccagcgatatcgcggctatcggtatcacc
aaccagcgcgaaacgacggttgtctgggataagaacacgggacgtcctgtgtacaacgct
atcgtttggcagtcccgccagacggctcccattgcggaagatctcaagaaaaaaggcctt
gtggatgaggtcaaggacaagactggtcttctgattgacgcttatttctccgctacgaaa
atcaaatggattctcgataaggtagaaggtgcccgggaaaaagccgaaaagggcgatctg
ctcttcggtaccatcgatacctggctgatctggaagctcacgggcggcaaggctcatgtg
accgactactccaacgcaagccgcaccatgctctacaacatcaacgagctcaaatgggat
gacgctctgctgggttacctcgatgtgcccaagtgcatgctgccggaagtaaaaccctct
tcctgcgtatatggcgaaaccattccgtccatcctgggcgcaccgattccggtatccggc
gctgccggcgaccagcaggctgccctcttcggccagaactgcttcgagccgggtatggct
aagaacacctacggcactggctgcttcatgctcatgaacaccggtacggaaatccataaa
tccaagaacggccttgtaaccaccatcgcctggggcctcgacggcaaagtggaatacgcg
ctggaaggttccatcttcgtggccggctctgctatccagtggctccgcgatggcgtgcgc
atggtggattccgctccggactctgaatgggtgtccaagaaggtcaaggacaacggcggc
gtctatgtggtaccggctttcgtaggcctcggcgctccgtactgggatatgaatgcccgc
ggcaccatcatcggcattacccgtggcaccactaaggcacatatcgtacgtgctaccttg
gaatcgctggcctatcagacccgtgatgtgctggaagccatggaggctgactccggcgaa
aagctctccgccctcaaggtggacggcggcgctgtagccaacaacctgctcatgcagttc
cagtccgacctgctgggcgtgcccgttgatcgtccgcagatcacggaaaccacggctctg
ggcgcggcttacttggctggcctggctgtaggcgtatgggacaacaaggaagaactcaag
agcagttggaagctggattcccgcttcgaatctcagatggaaaagacggaagcagatcgc
ctctacaagggctggcgcaaagccgtcaaacattccatgcattggctggatgaagaagat
tga

DBGET integrated database retrieval system