KEGG   Selenomonas ruminantium: SELR_02430Help
Entry
SELR_02430        CDS       T01799                                 

Gene name
bglA
Definition
putative 6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sri  Selenomonas ruminantium
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELR_02430 (bglA)
Enzymes [BR:sri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SELR_02430 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(281632..283062)
Genome map
AA seq 476 aa AA seqDB search
MGFPKGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVPREITDGVLPGKNYPNHE
AIDFYHHYKEDLALLAEMGFKCFRTSIAWTRIFPKGDEMEPNEAGLKFYDDLFDEMLKHG
IEPVVTLSHFEMPYHLVTEYGGWRNRKLVDFFVRFAVTCFKRYKNKVKFWMTFNEINNQR
EVNVPFMAFTNSGILYGENEDKYATLYQVAHHEFIASAKAVIEGHKINPDFKIGCMLAMG
PVYPETCRPGDQIASLKEMDKSFFFGDVQARGHYPSYIIKLWENKGYHVKMEDGDLDLLQ
QGKVDYFAFSYYMSNVTTSVEENKQSLQGGFATGVKNPYITESDWGWPIDPEGLRYMLNV
LQERYELPLMIVENGIGLHETAPAEGEIQDDARIDYFRAHIQEMKKAIDEDGVDLWGYCP
WGPIDLVSAGTGEMEKRYGFIYVDKDNEGNGTLKRARKKSFHWYKKVIASNGEDLD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggttttccaaaaggtttcttatggggtggcgcagtagctgcccatcagctcgaaggc
ggctggcaggagggcggcaagggcatcagcgtagctgacgtcatgaccgccggccggcac
ggcgtgccccgggagatcacggacggcgtgctccccggcaagaactaccccaatcatgaa
gccatcgatttctaccatcactacaaagaagatctggcattgctggcggaaatgggtttc
aaatgcttccgcaccagcatcgcctggacccgcatcttccccaaaggggacgagatggag
cccaatgaggcaggcctgaaattctacgatgacctctttgacgagatgctcaagcacggt
atcgaaccggtggtaaccctgtcccacttcgagatgccctaccatctggtgacggaatac
ggtggctggcgcaaccgcaagctggtggacttctttgtccgcttcgccgtgacctgcttc
aagcgctacaagaacaaggtcaaattctggatgaccttcaacgagatcaacaaccagcgg
gaagtcaacgtgcccttcatggccttcaccaacagcggcatcctctacggcgaaaacgag
gacaagtatgccaccctctatcaggtggcccatcacgagttcatcgcctccgccaaggcc
gtcatcgaaggccacaagatcaatccggacttcaagatcggctgcatgctggccatgggc
ccggtctatccggaaacctgccgtcccggcgaccagatcgcttccctcaaggaaatggac
aagagcttcttcttcggcgatgtgcaggcccggggccactacccctcctacatcatcaag
ctctgggaaaacaagggctaccatgtgaagatggaagacggggatctggatctcctgcag
cagggcaaggtggattacttcgccttcagctactacatgagcaatgtgaccacctctgtg
gaggagaacaagcagagcctgcagggtggctttgccaccggcgtgaagaacccttatatc
accgaatccgactggggctggcccatcgatccggaaggcctgcgctatatgctcaacgtc
ctgcaggagcgctatgaactgcctctgatgatcgtggaaaacggcatcggcctccacgaa
acggccccggcggaaggggaaatccaggacgatgcccgcatcgactacttccgcgcccac
atccaggaaatgaaaaaagccatcgacgaggatggcgtagacctctggggctactgcccc
tggggccccatcgaccttgtctccgccggcaccggcgagatggaaaagcgctacggcttc
atctacgtggacaaggacaacgaaggcaacggcaccctgaaacgtgcccgcaagaaatcc
ttccattggtacaagaaggtcatcgcttccaacggcgaagacctggactaa

DBGET integrated database retrieval system