KEGG   Selenomonas ruminantium: SELR_03290Help
Entry
SELR_03290        CDS       T01799                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sri  Selenomonas ruminantium
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SELR_03290
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SELR_03290
Enzymes [BR:sri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SELR_03290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
372067..373272
Genome map
AA seq 401 aa AA seqDB search
MDKMLKRRLMAAVVLVFLLAVLGGGLFASRLFPQVPAAVEKTKEALTGQETKRPLTIDEQ
VEEIVSSMSTTEKIGQLMVIGVQGTEANEDALYVLHQFHYGGIILFDRNLESKAQTKALV
QDLQAGADEKLPLFVGIDEEGGRVVRGKDFITPPPSQEAVGKQGEPQQAQKLAKSTAAEL
KEMGINVNFAPVADVGAADGRSYSKEPYETLKFVQAAGEGYKESGMVYALKHFPGIGRGL
VDSHKEISSIEAGESELRKVDLVPFREMINDTGKGKDLDYMVMVGHLNYPAFDKDNPASL
SRKIITDLLRQEMGYQGLVITDDLEMGAIANHRSFRQVGVEAILAGCDIVLVCHEYQHAE
DVYMGIYEAVQNGKISEMRLNESVRRVVKAKLLHGLRPADH
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggataagatgttgaagcggaggctgatggcggctgtcgttctggtattcctgctggca
gtgctggggggcggactttttgcttcccgcctgttcccccaggtgcctgcggccgtagag
aagacaaaggaagcgctgacagggcaggagacaaagcgcccgctgaccattgatgaacag
gtggaggagattgtttcctccatgtccaccacagaaaaaatcggccaattgatggtgatt
ggcgtgcagggaactgaggccaatgaagatgccctgtatgtgctgcatcagttccattat
ggcggcatcattctctttgaccgcaatcttgagagcaaggcccagaccaaggcgctggtg
caggatctgcaggccggagctgatgagaagctgccgctctttgtgggcatagacgaagaa
ggcggccgggtggtgcgcggcaaggatttcatcaccccacccccctcccaggaagccgtg
ggaaaacaaggcgagccacagcaggcgcagaagctggccaaatccacggcagccgagctg
aaggaaatgggcatcaatgtgaattttgcccctgtggcggatgtgggagcggctgacggc
cgttcctacagcaaggagccttatgaaactctgaaatttgtgcaggcggcaggcgagggg
tataaagagagcggcatggtctatgccctgaaacatttccccgggatcggccgcgggctg
gtggattcccataaggaaatctcctccattgaggctggggaaagcgaactgcgcaaggtg
gatctggtgcctttccgggagatgatcaatgataccggcaaaggtaaggatcttgactat
atggtgatggtgggacatctgaactatcctgcctttgacaaggacaatcccgctagtctg
tccaggaaaatcatcacggatctgctgcggcaggagatgggctatcagggccttgtcatt
accgatgatctggaaatgggcgccattgccaatcatcgctccttccgtcaggtgggcgtg
gaggccatccttgccggctgtgatatcgtgctggtctgccatgaataccagcacgccgaa
gacgtctatatgggcatctatgaagcagtgcaaaacgggaagatcagcgagatgcgcctg
aacgaatcggtacgccgggtagtgaaagccaagctcctgcacggtttgcgcccggctgat
cattga

DBGET integrated database retrieval system