KEGG   Selenomonas ruminantium: SELR_03940Help
Entry
SELR_03940        CDS       T01799                                 

Gene name
recD
Definition
(GenBank) putative exodeoxyribonuclease V alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sri  Selenomonas ruminantium
Pathway
sri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sri00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SELR_03940 (recD)
Enzymes [BR:sri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SELR_03940 (recD)
DNA repair and recombination proteins [BR:sri03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SELR_03940 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 HHH HHH_2 PIF1 Helicase_RecD DNA_pol_lambd_f PhoH AAA_22 AAA AAA_28 5_3_exonuc HHH_3 NTPase_1 TsaE T2SSE UvrD_C AAA_5 Mg_chelatase AAA_24 AAA_12 AAA_16 TrwB_AAD_bind AAA_33 AAA_29 P53_C UvrD-helicase
Motif
Other DBs
NCBI-ProteinID: BAL82102
UniProt: I0GMW5
Position
442004..444229
Genome map
AA seq 741 aa AA seqDB search
MAYNNDNEQMALGFAPQAGQEEIEGLVDSIIFASEDGRFAVFRLQPSGQNSRVTVTVSSE
PPLVGQQVYLTGSWITHPRFGQQFKAVSLRLEAPTSVEGIERFLASGVIDGVGPAMAKRL
VAKFGADTLDIIEQKPKLLETVEGIGKKTAAKIVASYTSQSELREIMLWLESHNVSGALA
ARIYKKYSSFALEVLENHPYKLAQEVEGIGFATADAIAASLGMAGDDENRVAAGIDYALQ
QISTSGHCCIPEEPLMDRTAKLLRVDSLRVGEVLKKQLKMQRLAVEEVGGTTLIYSPYLY
RAEKKVARKLLYLQRYADVLNVEDPEGMVAHWEEMTGLDLAQAQKEAMVAALTHGILVLT
GGPGTGKTTVVRGMIDVLEMAGLEILLGAPTGRAAKRLAEATGRKTMTVHRMLEAQGGRQ
DDGASMFAKDADEQLEADAIILDEVSMMDIVLMQHFLEAVPDGCHVILVGDVDQLPAVGP
GSVLKDILRSQVIPAVRLTEVYRQNEESTIVLNAHAINAGRLPLCKPAGDFQFWEIADPE
EVARNIVKLCVEILPKQGWNPLTDVQVLSPMHRQECGVENLNKLLQAALNPPAEYKAEYK
NSVRTFRLNDKVMQTKNNYSKMVFNGDIGFITAVESDHITVQFSEDLQVDYEKNELVELQ
LAYAMSVHKSQGSEYPVIILPLTAGHYIMLQRNLLYTAVTRASKQVILLGTKAALNTAVT
NDRTRKRYTLLAERLAGALNE
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtggcatataacaacgataatgaacagatggcattgggctttgccccacaggctggccag
gaggaaatcgaaggcctggtggacagcattatctttgccagtgaggatggcagatttgcg
gtcttccgtctgcagccttccggtcagaacagccgtgttacggtgacggtcagctcagaa
ccgccgttggtggggcagcaggtgtatttgacggggagctggattacgcaccctcgtttt
gggcagcagttcaaggctgtgagcctgcggctggaagcccctaccagcgtggaaggcatt
gagcgtttcctggcttccggtgtgattgacggcgtgggccccgccatggccaaacggctg
gtggcaaaattcggtgccgatacgctggatatcatcgagcagaaaccgaaactgctggaa
acagtggagggcattggcaagaagacggcggccaagatcgtggcctcgtatacgtcgcag
tcagagctgcgggaaatcatgctttggctggaaagccataatgtatccggcgcgctggcg
gccaggatctataagaaatatagttcctttgctttggaagtgctggaaaatcacccgtac
aagctggcgcaggaagtagagggcattggctttgctaccgcagatgccattgccgccagc
ctcggtatggctggggatgatgaaaaccgcgtggcggcaggtattgattatgccctgcag
cagatttccaccagcggtcactgctgcattccggaagaaccactgatggaccgtacggcc
aaactgctgcgggtggattccctgcgggtgggtgaagtgctgaaaaagcagctgaaaatg
cagcggttggctgtggaagaggttggcggcacaacgctgatctattccccttatctttat
cgggcggagaaaaaagttgcccgcaaactcctgtatctgcagcgctatgccgatgtgctc
aatgtggaagatcccgaggggatggtggctcattgggaggaaatgaccggccttgatctg
gcccaggcacaaaaagaagccatggtggcggcgttaacccatggcattctggtgctgacc
ggcggccctggtacaggcaagacgacggtggtgcgggggatgatcgacgtgctggaaatg
gccggtctggaaatcctcttaggagcacctacgggacgtgcggcaaagcgattggctgag
gctacggggcgcaagaccatgacggtgcaccggatgctggaggcccagggcgggcggcag
gatgatggtgcttcgatgtttgccaaggacgcagacgagcagctggaagccgatgccatc
atcctcgacgaggtttccatgatggatatcgtcttgatgcaacattttctggaggctgtg
ccggatggctgccatgtgatcctggtgggggacgtggatcagctgccggcagtggggcct
ggttccgtgctcaaggatatcctgcgttcccaggtcatccctgctgtgcgcctcacggag
gtttaccgtcagaatgaggagagcaccatcgtcttgaatgcccatgccatcaatgccggc
cgtctgcccctttgcaagcccgccggggattttcagttctgggagatcgccgatcctgag
gaagtggcccgcaatatcgtgaagctctgtgtggagattttgcccaagcagggctggaat
ccactgacagatgtgcaggtgctttcgccgatgcaccgtcaggaatgcggcgtggaaaac
ctcaacaagctgttgcaggcggccttgaatccgccggctgagtataaagccgagtacaag
aacagcgtccgcacctttcgtctcaatgacaaggtgatgcagacgaagaataactacagc
aagatggtgttcaacggtgatatcggttttatcaccgctgtggagtctgaccatatcacc
gtgcagttcagtgaggatctgcaggtggattatgagaaaaatgaactggtggagctgcaa
ttggcttatgcgatgagtgtgcataaaagtcagggcagtgaatatcctgtgatcatcctg
cccctgactgccgggcattatatcatgttacagagaaatctcctttatacggcagtcacc
cgcgccagcaagcaggtcatcctgttagggacgaaggcagccctgaataccgcggtcacc
aatgaccgtacccgcaagcgctataccctgctggctgaacgtctggcaggcgccttgaat
gaataa

DBGET integrated database retrieval system