KEGG   Selenomonas ruminantium: SELR_04400Help
Entry
SELR_04400        CDS       T01799                                 

Gene name
glgB
Definition
putative 1,4-alpha-glucan-branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sri  Selenomonas ruminantium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sri00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
500187..502391
Genome map
AA seq 734 aa AA seqDB search
MKTSDLSEFDRYLFHQGTNYHAYEMLGAHFVEQDGKQGIRFAVWAPHAKAVSVVGDFNNW
DTRVNPMHKIGDGEIWVAFVESLGEGELYKYAIEPQWGGPHIMKADPYGFYAEKKPETAS
RTFDMNHYKWSDDGWKVQKRKESSYDRPMLTYEVHLGSWRRNAEGEYLTYREAADQLIDY
VKDMNYTHIEFMPLCEHPFDGSWGYQATGYYAVTSRYGTPDDFRYLVDRAHQQGIGIIMD
WVPGHFCKDEQGLRHFDGLPLYESDNEQRAENWEWGTTNFDYGRTEVQSFLISNAMFWFE
EFHIDGLRIDAVANMLYLDYGRKDGEWMPNKYGDTGNLEAMDFLRKLNEAIFKFHPQALM
IAEESTSWPLISKPVYMGGMGFNYKWNMGWMNDMLKYVSLDPIYRKWNHDKVTFSFMYAF
SENFVLPLSHDEVVHGKCSLISKMPGDYWQKFAGLRCFFGYWMAHPGKKLLFMGGEFAQF
IEWNFDDELDWHLVKEFDKHAKMLAFSKALNKFYLDTRAFWQVDFDWNGFQWIDPNDNNN
SIVSFIRKAEDRNDFVIAISNFTPEVRQDYRIGVPAKGSYIEVFNSDETAFGGSGVKNVG
EIQSQDKPWHNREQSISLTIPPLATIYLRLKRQDGSNVSYPEEHSHVEAKGFEVGEDKSS
TAAIAATQKAPAKKSSAKKTTTKKTTTKSTTKTKKTTASRKTSAAKSVKTKAAPRTATRK
RAAKPLVEDAAVNA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacttctgatttgagtgagtttgaccgctatttattccatcagggaacaaattac
cacgcttacgagatgctgggggcgcacttcgtggagcaggatggcaaacaggggattcgc
tttgctgtctgggcaccacatgccaaggctgtcagcgtggtgggggatttcaacaactgg
gatacccgggtgaatcccatgcacaagattggtgatggggagatctgggtggccttcgtg
gagagtttgggggagggcgagctttataagtacgccattgaaccccagtggggcggcccc
catatcatgaaggcagatccttatggcttctatgccgagaagaagccggaaacggcttcc
cgcacctttgacatgaatcactataaatggagtgatgacggctggaaggtgcagaaacgc
aaggaatcttcctatgaccggcctatgctgacctatgaagtccatttaggttcctggcgc
cgcaatgccgagggtgagtatctgacctatcgggaggctgctgaccagcttatcgattat
gtgaaggatatgaactacacccatatcgaattcatgcccctctgcgagcatcccttcgat
ggttcctggggctatcaggccacaggatactatgcagtgaccagccgttatggcacgccg
gatgatttccgttatctggtggatcgagcccatcagcagggcatcggcatcatcatggac
tgggtgccggggcatttctgcaaggatgagcagggcctgcgtcatttcgatggcctgccg
ctctacgaatccgataacgagcagcgggcggaaaactgggagtggggtaccacgaacttc
gactacggccggacagaggtgcagagcttcctgatttccaatgccatgttctggttcgag
gaattccatatcgacggcctgcgtatcgatgcagtggcgaatatgctctatttggattat
ggccgcaaggatggcgagtggatgccgaataaatacggtgacaccggcaaccttgaagcc
atggacttcctgcggaaactcaatgaagcgattttcaaattccatccccaggcattgatg
attgccgaggaatctacgtcctggcccctgatatcgaaacctgtctatatggggggcatg
ggcttcaattacaagtggaatatgggctggatgaacgacatgctgaagtatgtgagcctg
gatcccatttatcgcaaatggaatcatgataaggtgaccttctccttcatgtatgcgttt
tccgagaactttgtcctgcccctgtcccatgatgaagtggttcacggcaagtgttctctt
atcagcaagatgcccggagattactggcagaaatttgccggtctccgttgcttcttcggc
tattggatggcccatccgggcaagaaactgctctttatgggcggtgagtttgcccaattc
atcgagtggaatttcgatgatgagctggattggcatctggtcaaggaatttgacaagcat
gccaagatgttggccttctccaaagccctcaataaattctatttggataccagagcgttc
tggcaggtggacttcgactggaatggcttccagtggatcgatcccaacgacaataacaac
agcatcgtgtcctttatccgcaaggcagaggatcggaatgactttgtcattgccatcagc
aacttcacgccggaggtgcggcaggattaccgcatcggcgtgccggccaagggcagctat
atcgaagtgttcaactccgatgaaacagccttcggcggcagcggcgtgaagaatgtgggg
gaaatccagagtcaggacaaaccctggcacaaccgggaacagtccatcagtctcaccatc
ccgccactggctaccatctatctgcggctgaagcgtcaggatggttccaatgtgtcctat
cctgaagagcacagtcatgtagaagccaaaggttttgaggtgggggaggataagtcctct
acggcggccattgcggctacccaaaaagctccggcgaaaaaatcttcagcaaagaaaaca
acaacgaaaaaaacaacgactaaatctacaacgaagaccaagaaaacgacagcaagcagg
aaaacttcagctgccaagtcagtgaaaacgaaggcagcgcccagaactgctactcgaaag
cgagcggccaaaccacttgtggaagatgccgcagttaatgcctaa

DBGET integrated database retrieval system