KEGG   Selenomonas ruminantium: SELR_04420Help
Entry
SELR_04420        CDS       T01799                                 

Gene name
malQ
Definition
putative pullulanase/4-alpha-glucanotransferase (EC:2.4.1.25 3.2.1.41)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sri  Selenomonas ruminantium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SELR_04420 (malQ)
Enzymes [BR:sri01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SELR_04420 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503932..507405
Genome map
AA seq 1157 aa AA seqDB search
MLTRNEVEHNSHNVYYRCPRGAAEAGSKVRLGLQIRSKQQINQVLLHVWQDKVGEKLLPL
ATKDPLDADHRYYFIDYEMPEKGDLLWYYFIISCSDGTCYYGNNHEQWGGQGEIYPHVPP
AYQITVYNKGAKTPDWFKHAIMYQIFPDRFARQGDRLIEKEGAVYHASWTDDPCYYKDPD
TKDIVAYDFFGGNIAGLMAKLDYLKDMGISVIYLNPVFESESNHHYDTGDYHKIDPILGT
NEEFHELVETAEKKGIRIILDGVFSHTGSNSRYFNRKGKYDGVGAFQSEKSPYYEWYSFR
NFPYEYDCWWNFDTLPNVRETTPSYMDFIIRNPDSVLHHWLKEGIAGWRLDVIDELPEPF
SQSFYAELKKTNKDAVMIGEVWEDASNKVAYGQPRKYLCGQEMDSAMNYPFRKILLDFLL
GYVPGRNTMRQFNSLRENYPPENFYAMMNLIGSHDVQRAITILGETPYYDGMPAIEQCRA
KLSPEMYKVGKARLKMAALFQMTYPGVPCIYYGDEIGMEGFKDPTNRRPYKWQGGDEELR
EYYRTIIKARNDNTALQTGELLSLTAEGDIIAFARVVRSGHDVFGGDAENGAFISVFNRS
RTDSQTVHLDISDFADGQFVDMVAVEGVKAEPLLSHRGRLDVKMPPLTGRLLRYEPLPRK
YERAAGILLHPTSLPSKYGIGDMGKEAYKFVDFLASAGLKVWQILPLGPVGFGYSPYQSP
SAFAGNPLLIDMDELLEHGWITQAEARVPYVSKSSFIDFERVISFKQKCFKKAWAAFQKS
KDVEMHGEFQAFIEEAASWLDDYALFDAAKKEFKNKPWFEWPEALVRREPKALKQLAEHM
EEAVGYAKFVQFIFHRQWKKLHAYANSKGIKIMGDMPIFISHDSADVWANQKLFDLNPDG
TAKTVAGVPPDYFSATGQLWGNPQYDWKAMEKENYNWWKKRFKNLHRLVDIVRIDHFRGF
ESYWEVDGKAETAINGHWRKGPGKEFFDIIKKEIGDMEIVAEDLGIITDEVEALRDACGF
PGMKVLHFTLHFNEQGRMGFVAPENSIVYTGTHDNNTTVGWYQHDLDDASRAAIASMLNV
KMDRPWEVAKGLMKFGLASEARLAIAPMQDVLGLDERARMNTPGTVGLNWKWCLKPDYLL
EVDAEKIKGLCKKYGRC
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
gtgcttacgcggaatgaagtagaacataactcacataatgtgtactaccgctgcccacgg
ggggcagccgaagcaggaagcaaggtgaggcttggcctgcagatccggagcaaacagcag
atcaatcaggtgcttttgcatgtctggcaggataaggttggcgaaaaactcctgcccttg
gcgacgaaagatccgttggatgcagatcaccgttattatttcatcgattatgagatgccg
gagaagggcgatctgctctggtattatttcattatttcctgcagtgatggcacctgctac
tatggcaataaccatgagcagtggggcgggcagggggagatttatccgcatgtgccgccg
gcctatcagatcacggtctacaataaaggggccaagacgccggattggttcaagcatgcc
atcatgtaccagattttcccagatcgcttcgcccgtcagggggacaggctcattgaaaaa
gaaggcgcagtctatcatgccagctggacggacgatccctgttattacaaggatccggat
accaaggatatcgttgcctatgatttctttggcggcaatatcgccggcctaatggcgaag
ctcgactatctgaaggatatgggcatcagcgtcatctatctgaatcccgtgttcgagtcg
gaaagcaatcatcattatgataccggggattaccataagatcgatcccatcctggggacg
aatgaagaattccatgaactggtggaaacagcggagaaaaagggtatccgcatcatattg
gacggtgtgttcagccataccggcagcaacagccgttatttcaaccgcaagggtaaatac
gatggcgtaggtgcttttcagtcagaaaagtcaccctattatgaatggtacagtttccgc
aatttcccttatgaatacgattgctggtggaatttcgataccctgcccaatgtgcgggag
acgacgccgtcctatatggatttcatcatccggaatccggacagcgtgctccatcattgg
ctcaaggaggggattgcaggctggcgtctcgacgtcatcgacgagctgcccgaacccttc
tcccagagtttctatgcggaactcaagaaaacgaacaaagacgccgtgatgatcggcgag
gtctgggaagatgcctccaacaaggtggcctatggtcagccgcgcaagtatctttgcggt
caggaaatggattcagccatgaattatcccttccgcaagattctgttggatttccttctg
ggctatgtgccggggcgcaataccatgcgtcagttcaacagcctgcgggagaactatccg
ccggaaaatttctacgccatgatgaacctgatcggcagccatgatgtgcagcgggccatc
acgattttgggtgagacgccttattatgacggcatgccggctatcgagcagtgcagggcc
aagctttcaccggaaatgtataaagtgggcaaggcccgtctcaagatggcggcgttgttc
cagatgacttatcccggtgtaccctgtatctattacggggatgagatcggcatggagggg
ttcaaggatcctacgaaccgccgtccttataaatggcagggcggggatgaggaactgcgt
gaatattaccgcaccatcatcaaggcccgcaatgacaatacggctttgcagaccggggaa
ctgctttccctgacggcagagggggatatcattgcctttgcccgcgtggtgcgcagcggt
catgatgtcttcggcggggatgcggaaaatggtgcgttcatcagcgtattcaatcgcagc
cgcacggacagtcagacggtgcatctcgacatcagcgactttgccgatgggcaatttgtg
gatatggtggcagtggaaggtgtgaaagcagaaccgctgctgtctcatcgcggcaggttg
gatgtgaagatgccgccgctgacgggcaggctcctgcgttatgaaccattgccccggaaa
tacgagcgggcggcagggattctcctgcatcctacctccttgccctcgaaatacggcatt
ggggatatggggaaagaggcttacaagtttgtggacttcctagcgtctgccgggctgaag
gtttggcagatcctgcccttagggcccgtgggctttggctattcgccctatcagtccccc
tcggcttttgccgggaatcctctgctgatcgatatggatgaactgctggaacatggctgg
atcacgcaggctgaagcccgggtgccctatgtcagcaagtcttcctttatcgacttcgag
cgtgtgatttccttcaagcagaaatgcttcaagaaggcttgggcggctttccagaagtca
aaggacgtggagatgcacggcgagttccaggcctttatcgaagaggctgccagctggctg
gatgattatgcccttttcgatgcggccaagaaagagttcaagaacaagccttggtttgag
tggccggaagcgcttgtgcgccgggaaccaaaagccctgaagcaactggcggaacatatg
gaagaggctgtgggctatgcgaaatttgtgcagtttatcttccatcggcagtggaaaaaa
ctgcatgcctacgccaacagcaagggcataaagatcatgggggatatgcccatattcatt
tctcatgacagtgccgatgtctgggccaatcagaagctgtttgacctgaatcccgatggt
acggctaagaccgtagcgggcgtaccgcctgattacttcagcgccacgggccagctttgg
ggaaatccccaatatgactggaaggccatggaaaaggaaaactacaactggtggaagaaa
cgcttcaagaatctgcaccgtctggtggatatcgtgcgcatcgaccacttccgcggcttt
gaatcctattgggaagtggatggcaaggcagagactgccatcaacggtcattggcgcaaa
ggccctggcaaggagttcttcgatatcatcaagaaagagattggtgatatggaaatcgtg
gcagaagatctgggcatcatcaccgatgaggtagaagctctcagagacgcctgcggtttc
cccggcatgaaggtgctgcacttcacgctgcatttcaatgaacaggggcggatgggcttt
gtggcgccggagaacagcatcgtctacacgggcacccacgataataacaccaccgtgggc
tggtatcagcatgatctggatgatgcatcccgggctgccatagcctccatgctcaatgtc
aaaatggatcgtccctgggaggtggccaaagggctgatgaagtttggtttggcttccgaa
gcaaggttggcgattgcgccgatgcaggatgttttagggctggatgaacgggccaggatg
aatacgcctgggactgtggggctgaactggaagtggtgcctgaagccggattacctgctg
gaagttgatgcagagaagatcaaagggctgtgcaagaagtacggtcgctgttag

DBGET integrated database retrieval system