KEGG   Selenomonas ruminantium: SELR_04700Help
Entry
SELR_04700        CDS       T01799                                 

Gene name
recR
Definition
putative recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sri  Selenomonas ruminantium
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sri00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SELR_04700 (recR)
DNA repair and recombination proteins [BR:sri03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SELR_04700 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538806..539402
Genome map
AA seq 198 aa AA seqDB search
MQYIAPLAKLIEHFRALPGIGNKTAVRLAYHVLDMDAEQAKKLATAIIEAKEKIGYCNTC
FNLSDQNPCAICAAEERDHSVICVVEQPQDVAAMERMRDYRGVYHVLHGALSPLEGVGPD
QIRIKELLGRLTDDTVKEVIMATNPNVEGEATAMYLAKLLKPMGVKVTRIAHGLPIGGDL
EYADEVTLSKAMENRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtacattgccccgctggcaaagttaatagagcattttcgcgcactgcctggtatc
ggaaacaagacggcagtgcgccttgcttatcatgtgctggatatggacgcggagcaggcg
aagaaactggcaacagccattatcgaggccaaggaaaaaatcggctattgcaatacctgt
tttaatttaagcgaccagaatccctgcgcaatctgtgcggcggaagaacgcgatcactcg
gtcatctgtgtagtggagcagcctcaggacgtggcggctatggaacgcatgcgggactac
cgcggcgtctatcatgtgctccatggtgcgttgtcccccctggaaggcgttggcccggat
cagatccgtatcaaggaacttttggggcggctcaccgatgacacggtaaaggaagtaatc
atggctaccaatcccaatgtggagggggaggccacggccatgtatctggccaaattgttg
aagcctatgggagtaaaggtcacacgaattgcccatggtctgcccatcggcggcgacctg
gaatatgcggatgaagtgacgctctccaaggcgatggaaaaccggagggaaatctaa

DBGET integrated database retrieval system