KEGG   Selenomonas ruminantium: SELR_06040Help
Entry
SELR_06040        CDS       T01799                                 

Gene name
dxr
Definition
putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sri  Selenomonas ruminantium
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SELR_06040 (dxr)
Enzymes [BR:sri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SELR_06040 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
671508..672659
Genome map
AA seq 383 aa AA seqDB search
MKNIAVLGSTGSIGTQTLEVVRRNPELFHISVLAANSRDELFEQQIREFEPELAVLADET
AYNRLKSRYSGKTQLAGGRQAFIDAAAFDGVDTVVTSMMGFAGLEPTMKALDAKKNIALA
NKETLVVAGEIVTRRAKEQGVKILPVDSEHCAFFQCLQGEKMKSIEKLLLTCSGGPFRGK
KREELLEATKAQVLAHPTWNMGQKITVDSASLVNKGLEVIEAKWLYDVSYDQIQVVVHPQ
SIVHSMVQFRDGAVIAQLGSTDMKLPIQYALTYPDRVQSEFDRLDFWQMQDLTFSKPDTD
TFKGLKFAYEAGAMGGSMPCVFNAANEVAVGAFLKDEIKFLDIYDIIEETMLKRECIMEP
TLEELFAEDRWAREFATEVLRKK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatattgcagtattgggttccactggttctattggtacgcagaccttggaagtg
gtgcgcaggaatcctgagcttttccatatcagtgtgttggcggccaattcccgtgatgaa
ctctttgagcagcagattcgagagttcgagccggaactggcggtattggctgatgaaact
gcctataaccgcctcaagagtcgttacagtggcaaaacacagctggccggcggccgtcag
gcctttattgatgcggcagcttttgacggcgtggacaccgtggttacctccatgatgggc
tttgccggtttggaacccaccatgaaggctttggatgcgaagaagaacatcgccctggcc
aataaggaaaccctggtggtggctggtgagatcgtcacccgccgcgccaaggagcagggc
gtcaagatcctgcctgtagacagtgagcattgtgccttcttccagtgcctgcagggcgag
aagatgaagagcatcgaaaagctgctgctgacctgttccggcggccccttccgtggcaag
aagcgggaagagctcttagaggccaccaaggcacaagttttggcccatcccacctggaat
atgggtcagaagatcacggtggattcggccagcctggtgaataagggcctcgaagtcatt
gaagccaagtggctttatgatgtaagttacgatcagattcaggtggttgtccatccccag
agcatcgtgcattccatggtgcagttccgggatggggctgtgattgcccagttgggttcc
acggatatgaagctgcccattcagtatgccttgacctatcctgaccgtgtgcagtcggaa
tttgaccgtctggatttctggcagatgcaggatttgacattcagtaagcctgacacggat
accttcaaggggttgaaatttgcttacgaggccggggctatgggcggttccatgccctgc
gtgttcaatgcggccaatgaagtggcggtaggggcattccttaaggacgaaatcaagttc
ctggatatctatgatatcatcgaagaaacgatgctgaagcgtgagtgcattatggaaccg
acactggaagaactctttgcggaagaccgttgggcaagggaatttgccacggaagtttta
cggaagaaataa

DBGET integrated database retrieval system