KEGG   Selenomonas ruminantium: SELR_06040Help
Entry
SELR_06040        CDS       T01799                                 

Gene name
dxr
Definition
putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sri  Selenomonas ruminantium
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sri00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
671508..672659
Genome map
AA seq 383 aa AA seqDB search
MKNIAVLGSTGSIGTQTLEVVRRNPELFHISVLAANSRDELFEQQIREFEPELAVLADET
AYNRLKSRYSGKTQLAGGRQAFIDAAAFDGVDTVVTSMMGFAGLEPTMKALDAKKNIALA
NKETLVVAGEIVTRRAKEQGVKILPVDSEHCAFFQCLQGEKMKSIEKLLLTCSGGPFRGK
KREELLEATKAQVLAHPTWNMGQKITVDSASLVNKGLEVIEAKWLYDVSYDQIQVVVHPQ
SIVHSMVQFRDGAVIAQLGSTDMKLPIQYALTYPDRVQSEFDRLDFWQMQDLTFSKPDTD
TFKGLKFAYEAGAMGGSMPCVFNAANEVAVGAFLKDEIKFLDIYDIIEETMLKRECIMEP
TLEELFAEDRWAREFATEVLRKK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatattgcagtattgggttccactggttctattggtacgcagaccttggaagtg
gtgcgcaggaatcctgagcttttccatatcagtgtgttggcggccaattcccgtgatgaa
ctctttgagcagcagattcgagagttcgagccggaactggcggtattggctgatgaaact
gcctataaccgcctcaagagtcgttacagtggcaaaacacagctggccggcggccgtcag
gcctttattgatgcggcagcttttgacggcgtggacaccgtggttacctccatgatgggc
tttgccggtttggaacccaccatgaaggctttggatgcgaagaagaacatcgccctggcc
aataaggaaaccctggtggtggctggtgagatcgtcacccgccgcgccaaggagcagggc
gtcaagatcctgcctgtagacagtgagcattgtgccttcttccagtgcctgcagggcgag
aagatgaagagcatcgaaaagctgctgctgacctgttccggcggccccttccgtggcaag
aagcgggaagagctcttagaggccaccaaggcacaagttttggcccatcccacctggaat
atgggtcagaagatcacggtggattcggccagcctggtgaataagggcctcgaagtcatt
gaagccaagtggctttatgatgtaagttacgatcagattcaggtggttgtccatccccag
agcatcgtgcattccatggtgcagttccgggatggggctgtgattgcccagttgggttcc
acggatatgaagctgcccattcagtatgccttgacctatcctgaccgtgtgcagtcggaa
tttgaccgtctggatttctggcagatgcaggatttgacattcagtaagcctgacacggat
accttcaaggggttgaaatttgcttacgaggccggggctatgggcggttccatgccctgc
gtgttcaatgcggccaatgaagtggcggtaggggcattccttaaggacgaaatcaagttc
ctggatatctatgatatcatcgaagaaacgatgctgaagcgtgagtgcattatggaaccg
acactggaagaactctttgcggaagaccgttgggcaagggaatttgccacggaagtttta
cggaagaaataa

DBGET integrated database retrieval system