KEGG   Selenomonas ruminantium: SELR_10010Help
Entry
SELR_10010        CDS       T01799                                 

Gene name
trpB
Definition
(GenBank) putative tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sri  Selenomonas ruminantium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SELR_10010 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SELR_10010 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SELR_10010 (trpB)
Enzymes [BR:sri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SELR_10010 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1086122..1087312
Genome map
AA seq 396 aa AA seqDB search
MTNPQGRFGIHGGQYIPETLMNAIIELEEAYNHYKNDPEFQKELTELLNDYAGRPSRLYY
AEKMSKDLGGAKIYLKREDLNHTGAHKINNVLGQALLAKKMGKTRLIAETGAGQHGVATA
TAAALMGMECVVFMGKEDTERQALNVYRMRLLGAKVVPVTSGTATLKDAVSEAMREWTTR
ISDTHYCLGSVMGPHPFPTIVRDFQAVISQEIKSQMLAKEGRLPDVVMACVGGGSNAIGS
FYHFIEDKEVKLIGCEAAGRGIDTFETAATINTGRLGIFHGMKSYFCQDENGQIAPVYSI
SAGLDYPGVGPEHAHLHDIGRAEYVAVTDDEAVDAFEYLSRMEGIIPAIESSHAIAYAMK
LAPKMDKDKIIVVTVSGRGDKDCAAIARYRGEDIHE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatccacagggacgctttggtattcatggtgggcagtacattcctgaaacgctt
atgaatgccatcattgaactggaagaagcttacaatcactataaaaatgatccggaattc
cagaaggaactgacagaactgctgaatgactatgcgggcagaccttcccgtttgtactat
gccgagaaaatgtccaaagatctgggcggggccaaaatctatctcaaacgtgaggatctc
aatcataccggtgcgcataagatcaacaatgtcctggggcaggccctgctggccaagaag
atgggcaagacgcgactgattgctgaaaccggtgcaggccagcatggtgtggccacggct
acggcagcagcgctgatgggcatggaatgcgtggtcttcatgggcaaggaggatacggag
cgtcaggccctcaatgtttaccgcatgcgcctgttgggtgccaaggtagtgcccgtcact
tccggcacggcaaccctcaaggacgcagtatccgaggctatgcgggaatggaccacccgc
atcagcgatacccattattgcttaggctctgtaatggggccccatccgttcccaacgatt
gtccgggatttccaggcggtgatttcccaggaaatcaagagccagatgctggcgaaggaa
ggccgtctgcccgatgtggtcatggcctgcgtgggcggcggttccaacgccattggcagt
ttctatcattttattgaagataaagaagtcaagctgatcggctgcgaagccgccggccgt
ggcatcgatacctttgagacggcagccaccatcaatacgggtcgcctgggtatcttccat
ggcatgaagtcttatttctgtcaggatgaaaacggtcagattgcgccggtgtattccatt
tccgccgggcttgattaccccggtgtaggaccggaacatgcccatctgcacgatatcggc
cgtgctgagtatgtagctgtcaccgatgacgaagcggtggatgcttttgaatatctgtcc
cgcatggagggcatcattcctgccatcgagtccagccatgccattgcctatgccatgaag
ctggcaccgaagatggataaggacaagatcatcgttgtaactgtatctggccggggcgac
aaggactgcgccgccattgcccgctatcggggggaggatatccatgagtaa

DBGET integrated database retrieval system