KEGG   Selenomonas ruminantium: SELR_10020Help
Entry
SELR_10020        CDS       T01799                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sri  Selenomonas ruminantium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SELR_10020 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SELR_10020 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SELR_10020 (trpA)
Enzymes [BR:sri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SELR_10020 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1087305..1088078
Genome map
AA seq 257 aa AA seqDB search
MSNIANAFKNGKAFIPFFTCGFPDMETSKAAIRAAVENGADLIELGIPFSDPTAEGPVIQ
RSTLGALKNGVTTNKIFKMVKELRQDVKIPLVFMTYANVVFSYGGEDFFAKCQEVGIDGL
ILPDLPYEEKEEFASLSEKYGVDLISMIAPTSHERIAMIAKEATGFIYVVSSLGVTGVRK
EITTNLAEMVEAIRKVTDVPCAIGFGIANPDQSKKMAKIADGVIVGSAIVKLLEKYGKEA
PEYVGAYVRSMHPKNLL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatcgcaaacgcattcaagaacggcaaagcctttattcccttttttacctgc
ggtttcccggatatggagaccagcaaggcggctatccgcgcggccgtggagaacggcgcg
gacctgattgagctgggcatcccgttctccgatcctacagcggaaggcccggtaatccag
cgttccacgttgggggcgctcaagaatggcgtcacgaccaataagatattcaagatggtc
aaggaattgcggcaggatgtaaagattccgctggtctttatgacctatgccaatgtggta
ttctcctatggcggggaagatttcttcgccaaatgtcaggaagtcggcattgatggcctg
atcctgccggacctgccctatgaagaaaaggaagaatttgccagcctcagcgaaaaatac
ggcgtggatctgatttccatgattgcgccgacatcccatgagcgcattgccatgattgcc
aaggaggcaacaggttttatctatgtggtcagcagtcttggggttacgggcgtgcgcaag
gaaatcacgacgaatctggcggaaatggtggaagccatccgcaaggtcacggatgtgccc
tgtgctatcggctttggtatcgccaatcccgatcagtccaagaagatggccaagattgcc
gacggcgtgattgtcggttcggccatcgtgaagctgttggaaaaatacggaaaagaagca
ccggaatacgtgggtgcctatgtgcgctccatgcatccgaaaaatttactgtaa

DBGET integrated database retrieval system