KEGG   Selenomonas ruminantium: SELR_10300Help
Entry
SELR_10300        CDS       T01799                                 

Gene name
gtaB
Definition
putative UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sri  Selenomonas ruminantium
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SELR_10300 (gtaB)
   00052 Galactose metabolism
    SELR_10300 (gtaB)
   00500 Starch and sucrose metabolism
    SELR_10300 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    SELR_10300 (gtaB)
Enzymes [BR:sri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SELR_10300 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115828..1116703
Genome map
AA seq 291 aa AA seqDB search
MQKIRKAVIPAAGFGTRFLPATKATPKEMLPIVDKPTIQYIVEEAKASGIEDILIISGHG
KRAIEDHFDSAPALEMELKKKGKDDLLQMVLETADINVHYIRQRYMRGLGDAILCARSFM
ENEPFAVLLGDDVVYNPQKPALAQLIDIYEATGGSVLGCQNVPEEKVSAYGIVAGTQTDN
SRLMRVSDMVEKPAREEAPSRMAVLGRYIIKPQIFDILAETKPGKGGEIQLTDALKVLAR
QDAVYAYDFEGKRYDVGDKLGFLKATVEFALRREDLGGAFKDYLTELTKSF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaatcagaaaagcagtaattccggcagcaggttttggtacgagattcctgcct
gccaccaaggcgacaccgaaggaaatgctgccaatcgtggataagccgaccattcagtac
atcgtggaagaggccaaggccagcgggatcgaggatatcctgatcatcagtggtcatggc
aagcgcgccatcgaagaccatttcgacagtgcgccggcgctggagatggaactgaagaag
aagggcaaggatgatcttctgcagatggtactggaaacagcggatatcaacgtccattac
atccgccagcgctatatgcgcggcctgggcgatgcaatcctctgcgcccgctcctttatg
gagaacgagccgttcgcggtgctcttgggtgatgatgtggtctataacccgcagaagccg
gcgctggcacagctgatcgatatttacgaggccacgggtggttcggtgctgggctgccag
aatgtgccggaggaaaaggtgtctgcctatggtatcgtagccggcactcagacggataac
agccgcctgatgcgggtatccgacatggtggaaaaaccggcccgggaagaggcacccagc
cgtatggccgtattggggcgctatatcatcaagccccagatctttgatatcctggccgaa
acgaagccgggcaagggtggggaaatccagctgacggatgccttgaaggtgctggcccgt
caggatgcggtctatgcttatgactttgagggcaagcgctatgatgtaggcgataagctg
ggcttcctgaaggctacggtggaatttgccctgcgccgtgaagatctgggcggtgctttt
aaggattatttgacggaacttaccaagagtttctga

DBGET integrated database retrieval system