KEGG   Selenomonas ruminantium: SELR_19610Help
Entry
SELR_19610        CDS       T01799                                 

Gene name
thrC
Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sri  Selenomonas ruminantium
Pathway
sri00260  Glycine, serine and threonine metabolism
sri00750  Vitamin B6 metabolism
sri01100  Metabolic pathways
sri01110  Biosynthesis of secondary metabolites
sri01120  Microbial metabolism in diverse environments
sri01230  Biosynthesis of amino acids
Module
sri_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SELR_19610 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SELR_19610 (thrC)
Enzymes [BR:sri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SELR_19610 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Ntox44
Motif
Other DBs
NCBI-ProteinID: BAL83669
UniProt: I0GSD2
Position
complement(2023867..2025354)
Genome map
AA seq 495 aa AA seqDB search
MNYSSTRGENVKLTSAQAIIKGLATDGGLFVPDSLPQVDQSFIEDLLPLSYEERAAKVLS
LFLTDYTAEEIKTCVNNAYGQGKFDCEDRAPVTDLGNMQVLELWHGPTSAFKDMALQLLP
QLMSTALKKTGEKSDVLILVATSGDTGKAALEGFKDVDQISIMVFYPEGGVSQIQQLQML
TQEGSNVNVTAVKGNFDDAQSGVKVIFGDKEFAEKLAQANVKLSSANSINWGRLVPQIVY
YFSAYADLRKAGTIKAGEEVNFTVPTGNFGNILAGFYAKQMGLPVHKLICASNANNVLTD
FLQTGRYDRNRDFYKTITPSMDILISSNLERLLYHVTGNKEQVAGWMAELAKTGNYEVDK
DTRGKIKEFFWADFVDDNATKACIRQVYEQHKYVLDTHTAVAYQVAKNYRHETKDDHVMV
VVSTASPYKFNGSVLEALQAETAGLDEFGLLDKLQSLNEQPIPAGLAALKTKEVRHKGVC
EKDKMAEAVLDFVKK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
ttgaattacagcagtacccggggagaaaatgttaagcttacttcggctcaggccattatc
aaagggctggcaacggacggcggtttgttcgtgccggacagtttgccgcaggttgaccag
tcattcattgaagatttgctgcctctttcctatgaggaacgggctgcaaaggtactgagc
ttattcttgacggattatacggctgaggaaataaagacctgtgtcaataatgcctatggc
cagggcaagtttgactgtgaagaccgggctccggtgacggatctgggcaatatgcaggtt
ttggaactctggcatggccctacgagtgcattcaaggatatggccttgcagctgctgccc
cagcttatgagcacagcgctcaagaagaccggggaaaagtcggatgtgttgattctggtg
gcgacttccggcgatacgggtaaagctgcgctggagggcttcaaggatgtggaccagatt
tccatcatggtcttctatccggaaggcggtgtcagccagatccagcagctgcagatgctc
acccaggaaggcagcaatgtcaatgtgacggcggtcaagggcaactttgacgatgctcag
agcggcgtcaaggtcatctttggtgataaggaatttgcggagaagctggcgcaggccaat
gtgaagctgtcttcggccaactccatcaactgggggcgtcttgtgccgcagattgtctac
tatttcagcgcctatgcagatctgcgcaaggctgggacaatcaaagccggagaagaagtc
aacttcaccgtgcctacgggcaacttcggcaatatcctggcgggcttctatgccaagcag
atggggctgcctgtccataagctcatctgtgcctccaatgccaataacgtgctgacggat
ttcctgcagacgggccgttatgaccgcaaccgtgatttctataagacaatcacgccttcc
atggatatcctgatttccagcaatctggaacgcctgctctatcatgtgacgggcaataag
gaacaggtggccggctggatggctgagttggccaagacgggtaactatgaagtggacaag
gacacccgtggcaagatcaaggaattcttctgggccgattttgtggatgacaatgccacc
aaggcctgcatccgtcaggtctacgaacagcataagtatgtgctggacacccatacggcg
gtggcttatcaggtggcgaaaaactatcgccatgagacgaaggatgaccatgtgatggtg
gtggtttccacggccagcccctacaagttcaatggcagcgtgctggaagccctgcaggca
gagacagccggccttgatgaattcggcctgctggacaagctgcagtccctgaatgaacag
cccattcctgcaggtttggcagccctcaagacaaaggaagtacgtcataaaggcgtatgc
gaaaaggataagatggcggaggccgtattggatttcgtcaaaaaataa

DBGET integrated database retrieval system