KEGG   Selenomonas ruminantium: SELR_22210Help
Entry
SELR_22210        CDS       T01799                                 

Gene name
cheB
Definition
putative chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sri  Selenomonas ruminantium
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sri02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sri02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2317107..2318222
Genome map
AA seq 371 aa AA seqDB search
MRDLRVFAIDNSITFQNTLVQELSRRLPSGSLVEHAAKPAEAMDKLPIFKPTIIVMNFAL
GSLLVNQEKFLPLLVKKYPQVPIVTYGILESGQKAAMILGASHYLKKPSIGQPMEPFYEN
LVSALLVSQGKNSTASLSSADIGGGAVVTREIWRASRPAQPPPPPKPAPSPMEPMINVPQ
NAAHIDLIAMGASTGGTEALSAIITKLEPPLPGIVIVQHIPPMFSKLFSERLNTESKLTV
KEAVSGDVVLPNHVYIAPGAKHMTISRMGTRYMLECKPGPPVHSVCPSVDVLFDSVADIA
GNHAMGIILTGIGKDGAAGLLKMRNLGSPTIGQDAASSTVYGMPKAAFEIGAVQQQLPLL
SIPQAIYKIVR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcgggatttaagggtgtttgccattgacaactccataacattccaaaacaccttggtg
caggagctatcaagacgtctccccagcggcagtctggtggaacacgccgctaagcccgcc
gaggccatggataagctgcccattttcaagcccaccatcatcgtgatgaactttgccctg
ggctctcttttggtgaatcaggagaaattcctgcccctgctggtcaagaaatatccccag
gtgcccattgttacctatggcatcctggaaagcggacaaaaggccgccatgatcctgggt
gcttctcattatctgaagaaaccctccatcgggcagcccatggaacccttctatgagaat
ctggtcagtgccctgcttgtatcccagggaaagaactccactgcctcccttagttctgcc
gatatcggcggcggagctgtggtcacccgggaaatctggcgggcctcaagacctgcccag
ccgccgccaccgcccaagccggcgccttcccccatggagcccatgatcaatgtgccgcaa
aatgcagcccatatcgatctgattgccatgggtgcctccaccggcggcaccgaagcatta
tccgccatcatcacgaagctggaaccgcccctgccgggcatcgtcatcgtccagcatatc
ccgccgatgttctccaagctgttctctgagcgcctcaatacggaaagcaaactgaccgtc
aaggaagccgtcagcggcgatgtggtgctgcctaaccatgtgtacatcgcgccgggagcc
aagcatatgaccatctcccgcatgggcacccgttatatgctggaatgcaagcctgggccg
ccggtgcacagcgtctgtccctccgtggacgtgctctttgacagcgtagctgacatcgca
ggcaatcatgccatgggcatcatcctcaccggcatcggcaaggacggcgccgcagggctc
ctcaagatgcgcaacctcggctcccccaccatcggtcaggacgccgccagctccaccgtc
tatggcatgcccaaggccgcttttgaaattggtgctgtacagcagcagctgccgcttcta
agcatcccccaggccatatataagatcgtaagatag

DBGET integrated database retrieval system