KEGG   Selenomonas ruminantium: SELR_23810Help
Entry
SELR_23810        CDS       T01799                                 

Gene name
hemD
Definition
uroporphyrinogen-III C-methyltransferase/uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sri  Selenomonas ruminantium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sri00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2497073..2498581)
Genome map
AA seq 502 aa AA seqDB search
MAGMVYLVGAGPGDYRLISMKAVDCLKMADVVVYDRLADDRILRWAPDDAEYIYVGKASS
NHTMKQEDINQLLVDKAKEGKCVVRLKGGDPFVFGRGGEEGLLLRENNLPFEIVPGITSA
ISVPAYAGIPVTHRAVATSFAVVTGHEDPTKGKSNMRWEHLATGVDTLVFLMGVANLPHI
TSKLIENGRSADTPAAVIRWGTKPEQRTLVTTVGKAAEDVAKNGIKPPAIFIVGEVVKLR
DSLQWFDNLSQRPLFGKRILVTRARSQASKLTAKLENLGAEVFEAPAISMADPADNYAAL
DKSIDHLQDYHWLIFTSANGVGRFFARLFKAGKDARALGYAKIAAIGSATAEKLHQYGLN
ADVVPAEYRAEGVLEALKGKLPPHAKILIPRAEEAREILPETLREMGAEVEVAAAYRTVC
GQVDGEALAAEIKDGQFDMVTFTSSSTVKNLVEIIGSADLLKDVKTACIGPITADTAKSL
GIEPDIVAEEYTIDGLVEAICK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaatggtttatttagtaggtgcaggccccggagattaccggcttatcagcatg
aaggcagtggattgcctcaagatggcagacgttgtcgtctatgaccgtctggctgatgac
cgcatcctgcgctgggccccggacgatgccgaatacatctatgtgggcaaggcctccagc
aatcacacgatgaaacaggaagacatcaatcagctgttggtggacaaggcaaaagaaggc
aaatgcgtcgtacgcctcaagggcggcgatcccttcgtctttggccggggcggcgaggaa
ggcctgctgctgcgggaaaacaacctgcccttcgaaatcgtgccaggcatcacttcggcc
atttccgtgccggcttatgcgggcattcctgtaacccatcgggcggtggccacatccttt
gctgtggtgacaggtcatgaagatcccaccaagggcaagagtaacatgcgctgggaacat
ctggccacgggcgtggatacgctggtattcctgatgggcgtagccaacctgccgcatatc
acgagcaaattgattgaaaacggccgcagtgccgatactccggccgctgtaatccgctgg
ggcacgaaaccggaacagcgcacgcttgtgaccaccgtgggcaaggccgccgaagatgtg
gccaagaacggcatcaagccgccggccatctttatcgtaggtgaagtggtcaagctgcgc
gacagcctgcagtggttcgataatctctcccaacgacctctgtttggcaagcggattctc
gtaaccagagcacgcagtcaggcatccaagcttacggcgaaattggagaacctcggagca
gaggtattcgaagcgccggcaatttctatggctgatccggctgacaactatgcggcgctc
gataagtccattgaccatctgcaggattatcactggctgatcttcacgagcgccaatggc
gtaggccgtttttttgcccgcctgttcaaggccggcaaggatgcccgtgctctgggctat
gctaagattgccgcaatcggttcggctacggcagagaaactccatcaatacggcttgaac
gccgatgtagttccggctgaataccgggcagaaggtgtgctggaagccctgaagggcaaa
ctgccgccccatgcgaaaatcctgattccccgtgctgaagaagctcgggaaatcctgccg
gaaactttacgggaaatgggcgccgaagtcgaagtcgccgccgcttaccgcacggtctgc
ggtcaggtggacggcgaagcgctggctgctgaaatcaaagacggccagtttgatatggtg
accttcacgagttcttccacggtcaagaatctcgtggaaatcatcggttcggcagacctc
ttgaaggatgtcaagaccgcctgcatcggccccatcactgccgatacggctaaatctttg
ggcattgagccggacatcgtagcagaagaatataccattgatggcttggtagaagccatt
tgcaaataa

DBGET integrated database retrieval system