KEGG   Selenomonas ruminantium: SELR_25110Help
Entry
SELR_25110        CDS       T01799                                 

Gene name
rbsK
Definition
putative ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sri  Selenomonas ruminantium
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sri00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SELR_25110 (rbsK)
Enzymes [BR:sri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SELR_25110 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2652875..2653783)
Genome map
AA seq 302 aa AA seqDB search
MEKVLVVGSLNMDFAVYMDRRPQAGETVMAQGMKLVPGGKGANQAYALGKLGADTSMIGA
VGDDTFGQQMLANLEHVSVDTAGIKQIAGVETGKAFIEIEDSGQNSISVIAGANASVDEG
LVLAQAERFAKADAVVMQLEIPVPSVIAAAKLAKKHNKTVVLDPAPARADLPDELWAQVD
ITKPNETELALLTGLPTNTEEEVVTAARSLIAKGVKNVLVTLGGDGTLLVNDSTVQKFPA
YKVKAVDTTAAGDCFLAAFMSRFDGENFATAVDFGAKASAIAVTRQGAQTSIPTVEEVEK
FN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggtattagttgtcggcagtctgaatatggattttgccgtttatatggacaga
agaccacaggccggggaaacggtcatggcccagggcatgaagctcgtgcccggcggcaag
ggggcgaatcaggcctatgcgctgggaaaattaggcgcggatacatccatgatcggtgct
gtcggtgacgataccttcggacagcagatgttggccaatctggaacatgtgtctgtggat
acggcaggcatcaaacagattgccggcgtggaaacaggcaaggccttcatcgagattgaa
gacagcggtcagaacagcatcagcgtgattgccggcgccaatgcctccgttgatgaaggt
ttggtgctggcgcaggccgaacggtttgctaaggccgatgccgtggtcatgcagctggaa
atacctgtgccgtccgtgattgccgccgccaagctggcgaaaaagcataataagaccgtg
gtgctggacccggcgccggcccgggctgatctgcctgatgaactctgggcccaggtggat
atcaccaagccgaatgaaacggaactggccctgctgaccggactgcccaccaatacggaa
gaagaggtggtgacggcagccagatccttgattgccaaaggcgtgaaaaatgtcctggtg
acgttggggggcgatggcaccctgctggtcaatgacagcactgtgcagaaattccctgct
tacaaagtaaaagctgtggataccaccgccgccggtgactgcttcctggccgcctttatg
agcagattcgatggtgaaaactttgccaccgctgtagattttggtgccaaagcttccgct
atcgccgtaacccggcagggagcacagacctccattccaacggtggaagaagttgagaaa
tttaattag

DBGET integrated database retrieval system